SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078038 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078038
Domain Number 1 Region: 208-272
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000442
Family RING finger domain, C3HC4 0.028
Further Details:      
 
Domain Number 2 Region: 18-42
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000589
Family CCCH zinc finger 0.0044
Further Details:      
 
Weak hits

Sequence:  FBpp0078038
Domain Number - Region: 300-325
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00157
Family CCCH zinc finger 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078038   Gene: FBgn0029152   Transcript: FBtr0078383
Sequence length 386
Comment pep:known chromosome:BDGP5:3L:21523059:21526813:-1 gene:FBgn0029152 transcript:FBtr0078383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVTSSDTAISGMALGRSQTICRYYVRGICRFGELCRFSHDLSRGRPECEEQVATDVLP
KPSTSSSSTIGSRSASISSQQRNWANAPVFVPSQKRYTAHEQSEFETTVDPEAVMEAQAG
ASYDTLAPGVSWAEVVGGPSSLNKEDYGEENSSCAWGEFSAYPIHMELCEMCDQYCLHPT
DQVQRRSHNRECLQQHEQAMELSFAIARSKDKTCGICFDTIMEKAGREKRFGILPNCNHI
FCLECIRTWRQAKQFENKITRACPECRVCSDFVCPSAFWMETKEEKDKLLNDYRAALGAK
DCKYFKKGEGKCPFGNKCFYKHALPNGDIVDVGLPKRTRKLQSQNEIIDLLDIYLWDYVD
RRDYHWLEMISSDITSSESSDYSDED
Download sequence
Identical sequences Q9VP20
FBpp0078038 7227.FBpp0078039 FBpp0078038 FBpp0078039 FBpp0293874 NP_001246867.1.81976 NP_524704.1.81976 NP_730653.1.81976 FBpp0078038 FBpp0078039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]