SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078288 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078288
Domain Number 1 Region: 252-311
Classification Level Classification E-value
Superfamily RING/U-box 7.54e-17
Family RING finger domain, C3HC4 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078288   Gene: FBgn0037384   Transcript: FBtr0078639
Sequence length 312
Comment pep:known chromosome:BDGP5:3R:1650327:1652298:1 gene:FBgn0037384 transcript:FBtr0078639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSTIFRFSADSNVSSSSSNSSVSDSSVDSHSSIESNSGHNTSVESQSSAESDSSADSH
SSLERPSPVERDLSVESDSSSATNTSESSVGEASNQLQSPQSNNPLNMANLSVSTEDAHS
QIRSLTQDVIQMEAELDRMNRYCEEVVAQIDTFATRTSTPTTRRIRRRTSPVEVIDLSHL
DRAPPVRSARNRDPDAFIDLCTPEGPRSRTVNLHSNDSLTILPRRSAENDPVVDLDVASP
PKRVNRDIDESQKEELYKCPICMDSVSKREPVSTKCGHVFCRECIETAIRATHKCPICNK
KLTARQFFRIYL
Download sequence
Identical sequences Q8I0J6
NP_731017.1.81976 FBpp0078288 FBpp0078288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]