SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078336 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078336
Domain Number 1 Region: 242-454
Classification Level Classification E-value
Superfamily MIR domain 1.39e-58
Family MIR domain 0.000000228
Further Details:      
 
Domain Number 2 Region: 455-625
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.88e-53
Family IP3 receptor type 1 binding core, domain 2 0.00000067
Further Details:      
 
Domain Number 3 Region: 1229-1381
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 6.8e-38
Family IP3 receptor type 1 binding core, domain 2 0.0049
Further Details:      
 
Domain Number 4 Region: 112-218
Classification Level Classification E-value
Superfamily MIR domain 0.000000000000889
Family MIR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078336   Gene: FBgn0010051   Transcript: FBtr0078687
Sequence length 2837
Comment pep:known chromosome:BDGP5:3R:1353301:1364584:1 gene:FBgn0010051 transcript:FBtr0078687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDNIIGSASFLHLGDIVSLYAEGSVCGFLSTLGLVDDRTVVCPEAGDLSCPPKKFRDCL
IKICPMNRYSAQKQFWKAAKQSASSNTDPNLLKRLHHAAEIEKKQNETENKKLLGTSIQY
GRAVVQLLHLKSNKYLTVNKRLPSLLEKNAMRVYLDANGNEGSWFYIKPFYKLRSIGDYV
VVGDKVILSPVNADQQNLHVAANYELPDNPGCKEVNVLNSSTSWKISLFMEHKENQEHIL
KGGDVVRLFHAEQEKFLTMDEYKKQYHVFLRTTGRTSATAATSSKALWEIEVVQHDSCRG
GAGDWNSLYRFKHLATGHYLAAEAEIDVSAGAMSATSASGHDLHLGDCSKDSGLSCSTMN
STINDKPKGKQYRLVSVPYSADIASVFVLDATTMARPDSLVPQSSYVRLQHICSNTWVHA
TSIPIDADDDKPVMSMVCCSPIKEDKEAFALIPVSPVEVRDLDFANDACKVLATVTSKLD
NGSISINERRALISLLQDIVYFIAGMENEQNKTKALEFTIKNPIRDRQKLLREQYILKQL
FKILQGPFQQHTAGDGPFLRLDELSDPKNSPYKNIFRLCYRILRLSQQDYRKNQEYIAKH
FGLMQKQIGYDILAEDTITALLHNNRKLLEKHITAAEIETFVGLVRKNMHNWDSRFLDYL
SDLCVSNRKAIAVTQELICKSVLSDKNKDILIETQVKALRTGSGPVRCYKGNSEDVCLAT
LAEDAGDDEDRSDVQSTSTTTTWDSASLNEDDGTPSTGDKYEIHLKWTGQPTSRSMADLA
SCDGGELEAAILNYYRHQLNLFSNMCLNRQYLALNELSPRLDIDLILKCMSDETMPYELR
ASFCRLMLHLHVDRDPQEPVTPVKYARLWSEIPSKMSIQDYDGKNQQPDQNKQACRAKFN
TTIAFVENYLCNVATKVWLFTDQEQNKLTFEVVKLARDLIYFGFYSFSDLLRLTKTLLSI
LDCVSDTSSGEFASTDIDSVEEETNAEAEGGVLRSIGDINTVMTSLALGSVGQAIAAPTI
SLQQRKSVSQLMKEYPLVMDTKLKIIEILQFILDVRLDYRISCLLSIFKREFDESEVAAS
AASNEASQQQSQQQEPQTPGSSNETDPLDSAESVAAGAAAAAATTARQKNIDLESIGVQA
EGIFDCERSDAANLDLDGQGGRTFLRVLLHLIMHDYAPLVSGALHLLFRHFSQRQEVLQA
FRQVQLLVSDSDVESYKQIKSDLDILRQSVEKSELWVYKAKATDELGATDAGGDAVSLEY
NAALSQEQRNEYRKVKEILIRMNKFCVTASGPGSVVKPRKHEQRLLRNVGVHTVVLDLLQ
NPYDEKDDELMKELMCLAHEFLQNFCLGNQQNQVLLHNHLDLFLNPGILEAKTVCAIFKD
NLALCNEVTDKVVQHFVHCIEIHGRHVAYLQFLQTVVRAENQFIRRCQDMVMQELINSGE
DVLVFYNDKGSFNHFVQMMQQQMLRMEKLSDDSPLKYHVELVKLLACCTMGKNVYTEIKC
NNLLSLDDIVTIICHPLCMPEVKEAYVDFLNHCYIDTEVEMKEIYASGHMWSLFEKSFLV
DINQLITNPAAASNKTLQAYVLNGVTNLLGSFFASPFSDQSAIVQSRQLIFVQLLQAAHR
ITQCRWLSLGDRFNVENCIRTLTESAKMRSIALPPELEQQVATMSSKTAMLTRQTTKWLL
ASKQPKYEAQQAASLMRWDRSIIEGLQDIVSLLEDQLKPVVEAELSLLVDILYRSELLFP
AGTEARKRCESGGFIRKLIKHTEKLLEEKEERMCVKVLRTLREMMAIDVNYGEKGDALRQ
TLLLRYFQTKSTPRLPEDEVPLLAAPLMDPAKQNHLVTHGPGAKYLQRAGKTLHEMQNHL
DREGASDLVVELVIKSVHSPNIFVEAVELGIALLEGGNPIIQKGMFQKFLSDDLNQAFFK
VFFEKMKDAQQEIKSTVTVNTTDIAAKAHEHKQDTNLELDKIARKHGLKSNGVVITEELK
RELHNAGLATARAYGNARNIHSGEESSAISVNSPLEDILAEKLEKHKDSRDQRNQLSNKV
LVMQPILRFLQLLCENHNPDMQNLLRNQNNKTNNNLVSETLMFLDCICGSTTGGLGLLGL
YINEHNVALINQTLEALTEYCQGPCHENQNCIATHESNGLDIITALILNNINPLGENRMD
LVLELKNNASKLLLAIMESRGDSENAERILYNMNPKQLVEVACKAYHQEELIDEQDDGDE
PDAGSDDDDATVSPREVGHNIYILCHQLAQHNKELAGLLKASEDPQSASFDAKTSQALMY
YATHTAQIEIVRNDRTLEQIVFPIPEICEYLTTDTKIKILNTAERDDQGSKVADFFDKAE
EMFNEMKWQKKLRSQPLLFWISSYMSLWSNILFNCVVVINMIVAFFYPFDNTVPELSSHI
SLLFWIITIFSLVIVLALPRESGIRTFIGSVILRFIFLLGPESTLCLLGVVTVTLKSVHI
VSIMGNKGTLEKQLIKIITDFQLLYHCIYIAFCFCGLIFHPFFYSLLLFDVVYREETLVN
VIRSVTRNGRSIVLTAVLALILVYLFSIIGYMFFKDDFLVSVDFEEQDNAPPPSVPLTLS
VPVSGDSCSAPDDLGNCQAAKEVAPPSAGGGEVKERSCDSLVMCIVTTLNQGLRNGGGIG
DILRAPSSKEGLFVARVIYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQQKEAILKTT
CFICSLNRSAFDNKTVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEFTGPESYVYAMVKAG
ILEWFPRLRAMSLAAVDADGEQIELRSMQAQLLDTQLLIKNLSTQLHELKDHMTEQRKQK
QRLGLLNTTANSLLPFQ
Download sequence
Identical sequences FBpp0078336 FBpp0078336 NP_730941.1.81976 7227.FBpp0078336 FBpp0078335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]