SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078420 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078420
Domain Number 1 Region: 23-240
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000714
Family Internalin LRR domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078420   Gene: FBgn0037294   Transcript: FBtr0078773
Sequence length 333
Comment pep:known chromosome:BDGP5:3R:985334:986627:1 gene:FBgn0037294 transcript:FBtr0078773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADIPNAVGIGQQNDCGLIRTCRMLHLKPTELISQLLPNTQVLQKLRYLSVGSMSQAALE
EVFTNCRQLESLLLCDTMGTGTTYDIRSIRLCQMLKVLLMPLNVGTPLAVCSLVNLTHLT
LQRHKLSQGMEWMPTVLAIIHTKRFDLQGLTFDGSGLAAPMNLSHLQLAQCTALTDLRLS
NCYLAETDSPPVPFSCQRLSFRRCIIGKSFGYMHPLLRKLDLFNCQILFETPMLRRLLNL
RRHQPIEGPLLLTFSQSLRLRSELTKWSQEDVSASSRWLQVKEVDPHQATTWHQPCRTLS
MKFGRAVSYIPDLNLPEESIPSAADVLSSLDSL
Download sequence
Identical sequences Q9VN80
FBpp0078420 FBpp0078420 7227.FBpp0078420 FBpp0078420 NP_649513.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]