SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078447 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078447
Domain Number 1 Region: 203-403,512-603,630-664
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.96e-56
Family Diacylglycerol kinase-like 0.0062
Further Details:      
 
Weak hits

Sequence:  FBpp0078447
Domain Number - Region: 38-82
Classification Level Classification E-value
Superfamily Arp2/3 complex 21 kDa subunit ARPC3 0.0471
Family Arp2/3 complex 21 kDa subunit ARPC3 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078447   Gene: FBgn0037315   Transcript: FBtr0078804
Sequence length 687
Comment pep:known chromosome:BDGP5:3R:1184585:1187788:-1 gene:FBgn0037315 transcript:FBtr0078804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQTKQPAGRSSTSAGDFVAPISSTSASKFTPCSASDHNVLLNNFQLKKKSYRVLLHGQQ
LVWERLQKIKQSPQGNEAKAPLPPDSPAQPGGICSYGPQSHVLHLDDVVSIRSGDTKASS
LKPPSPPGSERSSGCSGDVAQGKPTSQYLTINYAMRLSKSQTDCNRWELRRLTFFNSDPY
IVRQWDQELQIRLHSSSPTRMRVRRLLVFINPYGGRKAGAQTYERHVRPIFQLAGVDATC
ITTQRANQVKDILLSHDLGVYDAVCCVGGDGTVAEVINGLIFRQMRELGLDEQRPPYIPR
PALPVGVIPAGSTDTIAYSMHGTADVRTAAIHVILGQHRGLDVCSVSNGQSLLRFCASVL
SYGYLGDVAAQSENYRWMGPRRYEYSGVKAFLNNRGYDAELRMLEEPDLLLTTPLEDIPQ
SPDSVCSLGESVPSVCYANCQRCSFASSIQEQRSSLFIQEESKEAERNQQVETEDSHLAA
SEAALLRPRPRPGNLRLPTGSISSMRNLGNDQWKVVRGNFFMICGANITCACARSPNGIS
RYSHLGDGCLDLILVKKTSLLNNVRFLLNTAGRSGDIRNLPFVEVYRTREFRFRTFSASE
EDYSLAGSCQPITPPEEMTAHSSSTEFSSWNCDGEVVTDLDITMRSHCQLIEVFMRGPHS
YSKPLKGGTTPTTPASSSDNVYCCCKD
Download sequence
Identical sequences Q9VNA6
FBpp0078446 FBpp0078447 7227.FBpp0078446 NP_649530.2.81976 NP_730923.1.81976 FBpp0078446 FBpp0078447 FBpp0078446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]