SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078450 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078450
Domain Number 1 Region: 27-195
Classification Level Classification E-value
Superfamily MIR domain 2.22e-57
Family MIR domain 0.00000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078450   Gene: FBgn0037312   Transcript: FBtr0078807
Sequence length 216
Comment pep:known chromosome:BDGP5:3R:1179439:1180469:-1 gene:FBgn0037312 transcript:FBtr0078807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHILLLTGLALVGSISRGAATESNVVTCGSILKLLNSDYAFRLHSHDVKYGSGSGQQSV
TGVEQKEDVNSHWVIKAQTGELCERGEPIACGSTVRLEHLSTKKNLHSHHFSSPLSGEQE
VSAYGTDGLGDTGDHWEVVCSNENWMRSAHVRLRHIDTGMYLGMSGRSYGRPISGQMEIV
GVHKPQHGTRWTTAEGLFIVPKEKSSTHDEYAHSEL
Download sequence
Identical sequences Q9VNA3
7227.FBpp0078450 NP_649527.1.81976 FBpp0078450 FBpp0078450 FBpp0078450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]