SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078487 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078487
Domain Number 1 Region: 45-161,192-254
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000197
Family Internalin LRR domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078487   Gene: FBgn0037291   Transcript: FBtr0078846
Sequence length 550
Comment pep:known chromosome:BDGP5:3R:807721:809954:-1 gene:FBgn0037291 transcript:FBtr0078846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKSKSFDLVIEEKTKKPERLYQPRRMRWLKYIILPAVFSFALLLILVNVDFSDNSEDST
HLGNDTSLIISGYGFENNTLRRGFFSGGIALHSLVIENCTIVHINDAAFNQESTVNITSL
QLINVQLENLTESALEGLQKLQNFTLVNENNHFRPFGFLSAVAESLVSAEIHQSLAAAIS
YSVCDFLGSRNFPQLKYLDLSGTHLDKSLIKESFDNLPALEQLLLRNCGLGNIEWEIVRP
RLKLLHYLDLGGAQKTGNYEHQLDVSAFSPETTTNAEEISTILAKRAMAPEVVGTTTLGP
TTSIEISPPSTQSTTTPKEESTSMTETTILTTPSPKCEEELCQDLECSRITTDTVASADL
GKSSCQDGLLVEICESTCTTPTFFCVILGENFTSASNCCSHHTMRCVVSAQVSWFEDHSG
LVIGLGVGLLFIGSFLGMLIVFGTLRLNPSWLRGNKRRESNTIGLIQGRFEKDPYEQVGG
PIATIDNNEYVTAYHRYLEQANHRPTESNKYIRPPRDRAPSVPPSSDYPLPLPARNCNVY
ESCELYEELP
Download sequence
Identical sequences Q9VN74
FBpp0078487 7227.FBpp0078487 FBpp0078487 FBpp0078487 NP_649510.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]