SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078557 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078557
Domain Number 1 Region: 1156-1350
Classification Level Classification E-value
Superfamily Fibronectin type III 7.94e-31
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 943-1153
Classification Level Classification E-value
Superfamily Fibronectin type III 2.45e-28
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 3 Region: 755-845
Classification Level Classification E-value
Superfamily Immunoglobulin 7.8e-21
Family I set domains 0.024
Further Details:      
 
Domain Number 4 Region: 131-221
Classification Level Classification E-value
Superfamily C-type lectin-like 7.42e-17
Family C-type lectin domain 0.0038
Further Details:      
 
Domain Number 5 Region: 584-663
Classification Level Classification E-value
Superfamily Immunoglobulin 6.38e-16
Family I set domains 0.027
Further Details:      
 
Domain Number 6 Region: 660-753
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000838
Family I set domains 0.0087
Further Details:      
 
Domain Number 7 Region: 361-463
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000908
Family I set domains 0.0062
Further Details:      
 
Domain Number 8 Region: 851-947
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000007
Family I set domains 0.019
Further Details:      
 
Domain Number 9 Region: 487-545
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000013
Family I set domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078557   Gene: FBgn0037240   Transcript: FBtr0078917
Sequence length 1390
Comment pep:known chromosome:BDGP5:3R:207032:212741:1 gene:FBgn0037240 transcript:FBtr0078917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAKIGLLASILVLNLVGQITPQFSENLPDPDPQSGQQPQNYQPSYNKDYSPRYNPLYTG
QQSADPNQFDNTLVDGQSPNTYKGYYDGRAGGGGLGGNVVGPGNNLGGLGPQYDPFNRNS
IGSAGVSYRDAYTDEDNFCPEHWVSFRQTCYRFIRSPKRNWAEAKKICKAHNADLINVDN
VEKHSFILKNLILQNQRQNRFFISARQTGPLNWVNDDNTQLVQIEDSFSMDEQVPLENED
LHDNRFLVQNDLNNQNINNPNQFYNSLPGTVNQRNQNNLRGFIGPNQPYGDNRYVRDRVV
YAFSKKRDRWMFMPAYEIELNLFICESKVLYSSDNVNIKLDDKRPYHYGLDINDMERIPR
GPYFVKQPNDTTFDVNKNRLINDVTLSCLANGYPTPSYTWYREVYVDDRLEYQKIDPLAQ
DRYTISGGNLIIYEPKQALDQGAYHCVAENKFGRIRSESAHLNFGFIMEFNLKRSAETSE
MNWGKSIFCDPPQHYPDVRYYWARDYFPNFVEEDQRVFVSRDGALYFSFIETVDRANYSC
TVQTLVSDTGRNGPFFPLRVTPNSNYQALIFANTFPKVFPEAPVAGDEIRLECMAFGYPI
PSYNWTRQGLPLQRNAYTINYGRVLIIQNATTNDNGEYSCTITNPRKTLMKSIYINIQMR
PQFTIPLKDMIKDYNSDVTFICEAFAIPDANYTWYKNAERLDPANINRDRYIIQDNVLTI
KFLEKDKDDAMYQCGAQNQLKTSFSSAQLRVLSMKPSFKKHPLESEVYAVYNGNTTIVCD
PEAAPRPKFQWKKDGQVIGSGGHRRILPSGTLTISPTSRDDEGIYTCIASNQAGTDESHA
RVIVLQEIRFIETPPQRIVSKEHDLIFLHCEAAFDELLDIAYVWKHNGEVLKNNHDGTGR
IIVDWNRLTVHNTSMRDAGDYECVVKSAVNEISSKTSVSIEGAPGAPGGVQVIQISKTKA
IIEWVDGSHNGRAIRYYNILGRTNWNRTWVNVSTHVQAREVDRYTSRQQAEVVNLTPWSA
YEFSVTAVNDLGIGTPSAPSPIYSTYEDKPYIAPRNVGGGGGKIGDLTITWDPLLPQEQH
SHGIHYKVFWKLKGAIEWASDEIKKQDHMGVAVVNIPLNNYYTEYEVKVQAINSVGKGPE
SEIAVIHSAEDMPQVAPQKPIALAYNSTCFNVTWQPIDMSRENIRGKLIGHRLKYWKTTH
QEEDSVYYLSRTTRNWALIVGLQPDTYYFVKVMAYNAAGEGPESERFEERTYRKAPQKPP
SSVHVYGINPSTVRVVWRYVSPSQDEEPVEGYKVRIWESDQNMITANNTIVPIGQKLESY
INNLTPGKSYNMRVLAYSNGGDGRMSSPTLHFQMGKTTRNGANTRHGHNINTALILSTLL
LISTFLYTSQ
Download sequence
Identical sequences Q9VN14
FBpp0078557 FBpp0078557 FBpp0078557 7227.FBpp0078557 NP_649461.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]