SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078590 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078590
Domain Number 1 Region: 61-125
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000141
Family Variant RING domain 0.078
Further Details:      
 
Weak hits

Sequence:  FBpp0078590
Domain Number - Region: 163-211
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 0.0994
Family Substrate-binding domain of HMG-CoA reductase 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078590   Gene: FBgn0037242   Transcript: FBtr0078950
Sequence length 382
Comment pep:known chromosome:BDGP5:3R:221886:223609:-1 gene:FBgn0037242 transcript:FBtr0078950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADKAAAPSVDCAAPSVDCATPAIPAVEDHTTLTVPPASANKATDASTSTAVQVAVDGGE
PERCCWICFATDEDNRLAAWVKPCQCRGTTKWVHQSCLYRWIDEKTQKGNALRTVSCPQC
QTEYIIVFPQMGKLGGALEAIDNLIKRLSPFLAAGFFVGSLYWTAVTYGAVTFLQIVGHE
HGMSIMESGDPLVLLIGLPAIPVGLVLGRLIRWEDALLRLIRNRGTVVRKFPFVSLIYPN
LSQEEEQQSISNPATPALSDPVSATRVFCGALLLPTISSIVGRILFDTVDNTLHRTLLGG
LTFITVKGILKIYLKQKQYGRRKKRRIVDYTEENIRNFMHRNNNSAAAARQERLPEQRPV
PPAERRDAVITRQRGDSGGSVV
Download sequence
Identical sequences Q9VN18
7227.FBpp0078590 FBpp0078590 FBpp0078590 NP_001262253.1.81976 NP_649463.2.81976 FBpp0078590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]