SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078624 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078624
Domain Number 1 Region: 224-309
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.54e-21
Family Canonical RBD 0.0035
Further Details:      
 
Domain Number 2 Region: 162-184
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000249
Family CCCH zinc finger 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078624   Gene: FBgn0037220   Transcript: FBtr0078985
Sequence length 418
Comment pep:known chromosome:BDGP5:3R:56501:58054:-1 gene:FBgn0037220 transcript:FBtr0078985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMSKTTNTYNRQNWEDAEFPILCQTCLGDNPYVRMIKERFGKECKICTRPFTIFRWCPG
ARMRFKKTEICQTCARLKNVCQTCLLDLEYGLPIQVRDAALKVADNMPQSDVNKEYYIQN
IDAQLQDGDGTEAAGAVGRSLAANEMLSKLARTAPYYKRNRPHICSFWVKGECKRGEECP
YRHDKPNEPDDPLCEQNIKDRYYGRNDPVAEKIMKRAASLPTLEPPEDRNITTLYVGNLP
EEITEPELRDQFYQFGEIRSIALVPRQQCAFVQYTKRNAAELAAERTFNKLVIQGRKVSI
KWAHSQAKQGTAAKTDRRFDLAGIPPPSAKPNDYFNLRQEQINVMPAGMKLHQLPSNLVP
ASAYQMYGQPTYAAPYGNATSTALSSSGVNLDSISIPPPPGQVPYPSQDASRMGAVKK
Download sequence
Identical sequences Q95RB1
FBpp0078624 FBpp0078624 7227.FBpp0078624 FBpp0078624 NP_649440.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]