SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078812 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078812
Domain Number 1 Region: 83-152
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.44e-16
Family SAM (sterile alpha motif) domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078812   Gene: FBgn0031763   Transcript: FBtr0079181
Sequence length 256
Comment pep:known chromosome:BDGP5:2L:6020850:6021672:1 gene:FBgn0031763 transcript:FBtr0079181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFSASRCSTIPSPLPHSASGMDSPDICEPPQDEQEFCFRYPSYMFPDVEYDKEDVPLP
FKASPDSLFNLCAAVVDSQARTEVFKWSINDVTDWLRNFGYPEYEQTFRENYIDGHKLLN
LDAVALVALNVRNFEHIRHLGRGIRALYRKELQTATETKQQSEVYKTFRARTGRRYEGLR
ETELLGRMHMIRSVFRDVNDWDLMELHMSRAPVRRYREIVAGSRRYNLYGPSTARREPII
TDDVDATPWYNFEDCY
Download sequence
Identical sequences Q9VMJ2
NP_608980.1.81976 FBpp0078812 FBpp0078812 FBpp0078812 7227.FBpp0078812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]