SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078859 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078859
Domain Number 1 Region: 224-344
Classification Level Classification E-value
Superfamily SH2 domain 5.79e-24
Family SH2 domain 0.00075
Further Details:      
 
Domain Number 2 Region: 625-794
Classification Level Classification E-value
Superfamily Ras GEF 5.62e-23
Family Ras GEF 0.02
Further Details:      
 
Domain Number 3 Region: 45-101
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000058
Family SAM (sterile alpha motif) domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078859   Gene: FBgn0031762   Transcript: FBtr0079228
Sequence length 944
Comment pep:known chromosome:BDGP5:2L:6007364:6012338:-1 gene:FBgn0031762 transcript:FBtr0079228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTQARQLENRQVPNRRSSILWNFRYSNTVRRREDLAVMVHNSRMSISEWLDLLELQQY
EGNLQEFSTVDDVVDITDKELKQFGVRGAHRQRMVNSLLGVRAKRRQSMNLEAMSSAPRA
VPRRKNSCPLVYLGENPQDMAGSGDSGPGVITTKSGKVLKQLTFDETSTIYEELRPRSKC
NSPHWAIEDSRMEGYGSSNATTPLATAQPSPSEQQEAIALKKALEWELSLDARELRSHAW
YHGALPRQRAEEIVQREGDFLVRDCASQPDNYVLSCRSKAAVLHFVLNKLVLQPETVYER
VQYQFEEDAFDTVPDLITFYVGSGKPISSASGALIQFPCNRTYPLSFYGHKIVGNQLHTQ
MLAGLRGLSPLNSPMGSNGAVGAGMNATFRFEPQQQQQQQLSPMAGSPASPHCSPPRARR
EVPPPPRLPCKKQQRSQSLTPAQAMLVSNINKLQEQQLQMQELENGNGNGIMRFQTIARC
NPTSEQHLESKFTTHSLPRPNTSAAHALRQQAVARISSLARNCSLDSPSDSRPPSPPPKP
RKEPMAAVLAYQASGSDSGNGSGDSALGDACEASVQRGVIIKNPRFMTTSVSNGTLKSFT
EFDVLAAEEELFTMAIEEVKTASKFDFENFVTLLLPSVENKPLDGDALNTFKMMLLETGP
KLLAEHITRIDIALFLEEPSNEEDYYLSCSGLELLTLPHGKVFREDIIERTQCIKLMVAV
TILTCQTDLDRAQLLSKWIQIAVETKTALGNLFGFCAIMLGLCMQQIQKLDQAWHILRQQ
YTDSAFTFEAKLRPTLSIMNEASNPQAPNTTVPHVLLYALLIDRPVMDIINHSNIDDRPA
LYHTCIAPWESKADDFGMTINFQHLDASRGFLKNLELYRKNAKIILEDASPRLDELLADA
FRTEFHVKFLWGSSGATAKAEDRHNKLEKVLTLMADKFCMMAEQ
Download sequence
Identical sequences Q9VMJ4
FBpp0078859 7227.FBpp0078859 FBpp0078859 NP_608979.2.81976 FBpp0078860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]