SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078891 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078891
Domain Number 1 Region: 110-264
Classification Level Classification E-value
Superfamily TPR-like 0.00000000854
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078891   Gene: FBgn0027496   Transcript: FBtr0079261
Sequence length 306
Comment pep:known chromosome:BDGP5:2L:6489092:6490195:1 gene:FBgn0027496 transcript:FBtr0079261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQQNEEDTNSVLFDARNEYYIGNFMGSINFVLPEQGTAGPELLSYMYLSYLAIDSGRI
VASDIKEGNSTPLQALRLVHEAFEQPSRTEELLEKLTDKVAGEEDETNIWHLATAIVYCH
DGQFENALKILHGSTNLESMALSVQCLLRLQRVDLAKQLVAKMQEISDDATLTQLAQAWV
ALAQGTEQMQDAFHIYQEFCEKFKPTPALLNGQAVVHLGLERYEEADSVLRESLLKKHND
YDTLINLMVHAHLTGKPTEAITRNLEQLRQFYPKSDFVTDLDKKSAEFDRLCLQYDVEGG
EKLLAV
Download sequence
Identical sequences Q9Y0Y5
FR729 FBpp0078891 FBpp0078891 7227.FBpp0078891 FBpp0078891 NP_609037.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]