SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078927 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078927
Domain Number 1 Region: 902-983
Classification Level Classification E-value
Superfamily RING/U-box 2.03e-24
Family U-box 0.0000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078927   Gene: FBgn0028467   Transcript: FBtr0079297
Sequence length 993
Comment pep:known chromosome:BDGP5:2L:6658507:6662033:1 gene:FBgn0028467 transcript:FBtr0079297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSIEENPFAALLQEGANSDGVPHKLVEEVLLFTLNKASSSAVLCLADVVVETSEEMLSE
DLVAHALFERLMLAETSQYAAGNASEMAMERRAMRYLKGAFTRCGLIQAERKIDCSKILA
LILNNASTCMRQPDLFAPQSFGAQWMEMFEQDEDEHDTSTQEFLIRVTCKVMEEVEPIEA
LGALKAIFYPVLTELQKNIAKLNLITMKKNTFWILGYFVRDKRAAVLGELLIDYTTPNPR
ASGSEYMDTLLGSLLCISILPKTQTGKYEFFQELSINQTDEALWALLSHHQQSIFLLVKQ
LLVLSPETKKKTLQWVGNCLDANVPRGHLWSSINASLEQTAHSTSSDAFMTNLTAVLVRL
CAPLCMPSLKVLLVDPTYCAVPNKDRQAKGVSMLRAHAETCLLTSEEGEERLTAEKYNFV
TEIFYMTHKCFELSNIPCIERFVRVLRELQNTQMAYGEIVNSDPNSEVAKNLFRMIRDQI
QQVLTIKNTLAEPTNDMYLLKFFEASAIWLTEIAMLPREIYEQCLDKRDFSPQVFRNMEL
LSDTPPFVAPYMQSVPESIIDNISAFLNAARKLNGEQYINIYFSAHDAFFKMIILFMGSS
ALVKNPHLRAKLAEALEFLLPSRIMGSHRKTFVSHVFDNHPDRLKVVRSLLNVFVSIEMT
GQSVQFEQKFNYRRPMYAIMEFLWTKPEHVQCFRDLAVEAEQNMDAIEPPIFLRFINLLI
NDAIFLLDESLSNLEQIKQLQQAQDNGEWESLPHTEREQHMTNLQHLGMLARFDNIIGRD
TINLLKLLTSKIKSIFCHNSMVDRMAAMLNYFLLNLVGPKKERFKVKDKKEFEFDPAQTV
IEISHIYINLSSDESFCLAVSQDGRSYSEQLFSYAENILIRIGGGQLIGDMSEFAVKVAR
MGAQYKEEQELLADAPEEYLDPIISTLMTDPVVLPSSKVTVDRSTIARHLLSDQTDPFNR
EPLTMDKVKSNEALKQEIESWIQGKREAARSNS
Download sequence
Identical sequences Q9U4F8
FBpp0078927 7227.FBpp0078927 NP_609060.1.81976 FBpp0078927 FBpp0078927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]