SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0078931 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078931
Domain Number 1 Region: 1029-1097
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000265
Family SAM (sterile alpha motif) domain 0.03
Further Details:      
 
Domain Number 2 Region: 940-1016
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000102
Family SAM (sterile alpha motif) domain 0.031
Further Details:      
 
Domain Number 3 Region: 1112-1150
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000853
Family SAM (sterile alpha motif) domain 0.067
Further Details:      
 
Domain Number 4 Region: 257-517
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000209
Family Tropomyosin 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078931   Gene: FBgn0046704   Transcript: FBtr0079301
Sequence length 1201
Comment pep:known chromosome:BDGP5:2L:6723903:6731600:1 gene:FBgn0046704 transcript:FBtr0079301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWNMMCDVMPTISEDSISQRSSQFSGEDANFEQLMVSMLDERDKLMDSLREAQERLNETE
NKLRDVEKERDSLQRQINANLPQEFATLTKELTQARETLLERDEEIGELKAERNNTRLLL
EHLECLVSRHERSLRMTVVKRQAAAQSGVSSEVEVLKALKSLFEHHKALDEKVRERLRLS
IEKNNMMEEELSSAKEELAQYKAGVVPAGVGSGSGAGSAATTAGGGGAENGLKEKMAGVG
GSGGVNGEANELNDYAAKTHELQTIIEKQTSELSQWQRRVSDLNNKISELEENMSRVQKE
HCKAQDQCAKLQRDLRENVAQKEDQEERITTLEKRYLNAQRESTSLHDLNEKLEQELRHK
EAQLKLHEEKIGAIEEKLELSEQKLAQHAKLQPDMEEQLKARMEALTKAQERHGSAEDRI
RGLETNLDEKTNEVVRLNQRLKMNEEHNLRLSSTVDKLLSESNERLQVHLKERMHALDEK
NALTQELEKARKVAEELHHEKSEIMKELSKTRLEIENFKRQLLQQEIAYNIQQTEALTRS
LSPSSVVDPSGAFSRSNSHASFETHSLRRQSKQRLSEENALVRSMAEQEWEKLQQAAHAQ
QQAYELASAADCDDSDVLYAAATDMMSPSGHTDAQTLAMMLQEQLDAINNEIRLIQEEKQ
STEARAEELESRVGSLEHVNLLARGRSMDRQSPPMSGRSTPNSPQRDFMQKYHTLNLPVL
SSDASREELHGGMSTTGDSSSGGAASPLTARSMRLERVAQALAHSQEELRRRSIGLNPNA
SVAPNHTGGHMPLSSHSYGLSPLSSRYGSQESLRHYNTMGSMSMLQTPTSGVSREAAAAA
VQKKKGIKSSLGRFFSKKEKVKGVKDTLPDGSPSMMSIGNLSIGLSEVDSNYDAMSMTGG
MMPRIASSQGSKISSVDYGRQKKEHDYRNDLLGEAMKAGTPFALWNGPTIVAWLELWVGM
PAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPQTS
RTTLAFGDMNHEWIGNYWLPGLGLPQYRTTFMECLVDARMLDHLTKKDLRGQLKMVDSFH
RTSLQYGISMLKRLNYDRTELEHRRKMSENGLCDVLVWSNERVIRWVGSIGLKEYANNLL
ESGVHGGLMALDEGFDANAMGLALQIPTQNAQARQILDTEFNNLLQIATDRRPENEQRSA
S
Download sequence
Identical sequences Q9VM93
7227.FBpp0078931 NP_609067.2.81976 NP_723208.1.81976 FBpp0078930 FBpp0078931 FBpp0078930 FBpp0078931 FBpp0078930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]