SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079155 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079155
Domain Number 1 Region: 206-520
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.25e-102
Family Transglutaminase core 0.000000129
Further Details:      
 
Domain Number 2 Region: 14-205
Classification Level Classification E-value
Superfamily E set domains 4.55e-42
Family Transglutaminase N-terminal domain 0.00082
Further Details:      
 
Domain Number 3 Region: 535-650
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.63e-26
Family Transglutaminase, two C-terminal domains 0.0013
Further Details:      
 
Domain Number 4 Region: 650-750
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.85e-21
Family Transglutaminase, two C-terminal domains 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079155   Gene: FBgn0031975   Transcript: FBtr0079533
Sequence length 776
Comment pep:known chromosome:BDGP5:2L:8011405:8026898:1 gene:FBgn0031975 transcript:FBtr0079533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKLSCCQKCGDWKWCTSKDNEESTLRIRNANANYFTGIPQGDKTDGASSAVLGVLKVD
LCLEDNHEEHHTSHFYAAAAKEALVVRRGEPFRLKIHFNRDYSPSKDAISFIFTVADDTK
PSPGHGTLNALVPHDGIDYLGDTLEWGAGIESHEGQTLTVLIKPPSTCPVTEWKLDIDTK
LLGDGSRSYPLPLPIYVLFNPWCPDDQVYLEDRDQRKEYVMHDTTLIWRGSYNRLRPSVW
KIGQFERHVLECSLKVLGTVGRIPPAYRGDPVRVARALSALVNSVDDDGVLLGNWSEDFS
GGVAPTKWTGSVEILQQFYKTQKSVKFAQCWNFSGVLTTIARSLGIPSRIITCYSSAHDT
QASLTVDVFIDANNKKLDAETTDSIWNYHVWNELWMQRPDLGVGEHGTFDGWQVVDATPQ
EASDNMYRVGPASVAAVKNGDILRPFDGGFVFAEVNADKLYWRYNGPSQPLKLLRKDTLA
IGHLISTKAVLKWEREDITDTYKHAERSEEERSTMLKALKQSRHAFSRYYLNDNFNDIEF
DMELKDDIKIGQSFSVVLKVSNKSESRTHMATGQISCDAVLYTGVGAVEVKTLGFELELE
PKSSDYVRMEVIFEEYYDKLSSQAAFQISAAAKVKDTDYDYYAQDDFRVRKPDIKFQLGE
AAIVAQKELDVILRLENPLPIPLHKGVFTVEGPGIEQPLKFKIAEIPVGGTAAATFKYTP
PYAGRGTMLAKFTSKELDDVDGYRHYEIEPRPEDLLQPNGSHRSSNIIRRRTDVIA
Download sequence
Identical sequences Q9VLU2
FBpp0079156 FBpp0079155 FBpp0079155 7227.FBpp0079155 NP_609174.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]