SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079156 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079156
Domain Number 1 Region: 198-512
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.09e-102
Family Transglutaminase core 0.000000129
Further Details:      
 
Domain Number 2 Region: 22-197
Classification Level Classification E-value
Superfamily E set domains 4.2e-40
Family Transglutaminase N-terminal domain 0.00082
Further Details:      
 
Domain Number 3 Region: 527-642
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.37e-26
Family Transglutaminase, two C-terminal domains 0.0013
Further Details:      
 
Domain Number 4 Region: 642-742
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.59e-21
Family Transglutaminase, two C-terminal domains 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079156   Gene: FBgn0031975   Transcript: FBtr0079534
Sequence length 768
Comment pep:known chromosome:BDGP5:2L:8012772:8026849:1 gene:FBgn0031975 transcript:FBtr0079534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYWYRNYTPSWLQRWWPNSQPRRVNPFRNTRPSADLEDGASSAVLGVLKVDLCLEDNHE
EHHTSHFYAAAAKEALVVRRGEPFRLKIHFNRDYSPSKDAISFIFTVADDTKPSPGHGTL
NALVPHDGIDYLGDTLEWGAGIESHEGQTLTVLIKPPSTCPVTEWKLDIDTKLLGDGSRS
YPLPLPIYVLFNPWCPDDQVYLEDRDQRKEYVMHDTTLIWRGSYNRLRPSVWKIGQFERH
VLECSLKVLGTVGRIPPAYRGDPVRVARALSALVNSVDDDGVLLGNWSEDFSGGVAPTKW
TGSVEILQQFYKTQKSVKFAQCWNFSGVLTTIARSLGIPSRIITCYSSAHDTQASLTVDV
FIDANNKKLDAETTDSIWNYHVWNELWMQRPDLGVGEHGTFDGWQVVDATPQEASDNMYR
VGPASVAAVKNGDILRPFDGGFVFAEVNADKLYWRYNGPSQPLKLLRKDTLAIGHLISTK
AVLKWEREDITDTYKHAERSEEERSTMLKALKQSRHAFSRYYLNDNFNDIEFDMELKDDI
KIGQSFSVVLKVSNKSESRTHMATGQISCDAVLYTGVGAVEVKTLGFELELEPKSSDYVR
MEVIFEEYYDKLSSQAAFQISAAAKVKDTDYDYYAQDDFRVRKPDIKFQLGEAAIVAQKE
LDVILRLENPLPIPLHKGVFTVEGPGIEQPLKFKIAEIPVGGTAAATFKYTPPYAGRGTM
LAKFTSKELDDVDGYRHYEIEPRPEDLLQPNGSHRSSNIIRRRTDVIA
Download sequence
Identical sequences Q8IPH0
FBpp0079156 NP_723332.1.81976 FBpp0079156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]