SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079210 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079210
Domain Number 1 Region: 748-849
Classification Level Classification E-value
Superfamily E set domains 8.67e-17
Family Filamin repeat (rod domain) 0.0042
Further Details:      
 
Domain Number 2 Region: 538-593
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000183
Family B-box zinc-binding domain 0.0056
Further Details:      
 
Domain Number 3 Region: 302-334
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000429
Family RING finger domain, C3HC4 0.034
Further Details:      
 
Weak hits

Sequence:  FBpp0079210
Domain Number - Region: 417-429,465-489,552-563
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.046
Family Di-heme elbow motif 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079210   Gene: FBgn0031999   Transcript: FBtr0079589
Sequence length 921
Comment pep:known chromosome:BDGP5:2L:8206206:8209639:1 gene:FBgn0031999 transcript:FBtr0079589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRENRSKIAFKRKTSNGNKSGQLTDYERIRGDVEIVVPSPPPTPAVPPSASLGKLKIKL
SSAKISLRKNAQTSQNNLQTAPLPDAVRRKSAPQLFTFTIAPKSEVTSKIHLPSVPKLPG
LAPKSSIRRSRTLGLSNSAQGAGSSGTGLSNVELGVQDRDSGSEPTSSLAGGGSSTSPES
LLDNILSGASSVSVQSSSSSQASNATVAQPIKAKEQLHPKRLLSLKASPELRVSPPTPDT
TQPQVQMPTQLLLSLTPRPEVFDAPSPLTRSPSRSPGISPPVSPSPSITLRPSTPPENTV
IFTDDLKCGICLDVYTDPRTLHCLHSFCLQCLVSENFKDESLWDQDQARSEEPSNYSLRS
EMGGSSAELTATVSPARQRGSSFTLRRKKSMDRLVIRSKSDGKRSTSSIGTRFTGSFASE
VSTRCIRCHTCNYPTDLSLGGVRQLPQNYLLVRRIEVLRLQAGEDVISRVWCSLCTEEIS
ATYHCISCTLNLCTLCKEAHERQRSTASHRMRSILELRRARKQKQQQMGLGDSSKLVLRC
GIHTNFELKAFCTNCRQLACTDCLVILHKGHRHETISRAIGHQGKLLKEATDQTRPLCQY
AEHSIERLNAIARGINDRCDDIQTQVERYMQQYMDALTVHRKTLLQQISRARESKVEVVL
KQQLDLEKRTQQAMDAVRFSQELCEIGADVEILSYVTILLRRLEYCQQFKPPVDPKISDS
LHFLPKIRAPSTKDQRDIPLYGIITMQVVEPSLCTLEWEGFSQLRLHKKADLLLHSRDAD
GVSLCHGGLEINCMLKYKDSSSKFLPVEVSDNRDGTYNISFTPDAQGTLILTITINDRPI
KGGPFTFQARQVRPHTGIYHCCSFCSGKGNRNVMCSCEGHMPGYSGCGHGHAGHPGRRHW
SCCGNVLENSECNVANKLLNS
Download sequence
Identical sequences Q9VLR7
7227.FBpp0079210 NP_609193.1.81976 FBpp0079210 FBpp0079210 FBpp0079210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]