SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079247 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079247
Domain Number 1 Region: 73-212
Classification Level Classification E-value
Superfamily PX domain 0.000000000000196
Family PX domain 0.0088
Further Details:      
 
Weak hits

Sequence:  FBpp0079247
Domain Number - Region: 251-440
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000994
Family BAR domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079247   Gene: FBgn0032005   Transcript: FBtr0079631
Sequence length 449
Comment pep:known chromosome:BDGP5:2L:8218071:8220741:-1 gene:FBgn0032005 transcript:FBtr0079631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDGTDDSNLLNSPSTNNGATMEIASPTNPLATPPATGGAPAPSGATNGSGSATSPDSSS
SAPATPAVLGENALHVEISDALSEKEKVKFTVHTRTTLPGFSKKDNNVVRQHEEFVWLHD
RIEENDDYAGYIIPPCPPRPDFDASREKLQRLGEGEGNMTKEEFKKMKSELEAEYLATFK
KTVAMHEVFLRRLASHPVFRVDQHLKVFLEYDQDLCAKPRKKMAIFGGFVKSLGKTTDEI
LLSATVRDVNDFFENELQFLTEYHGHLREAALRTEKMTQRHKDVGDSHQKISNALTQLST
TEKGNVETFVAKTAEIFERIKNLETRVASDQDLKLGDTLRYYQRDSDAAKALLIRRLRCL
AAYEAANRNLEKARSKNKDVHAAETAQAEACEKFESMSACGKEELIGFRNRRVAAFKKSL
VELSELEIKHAKTQYEYLRQSLLALKEIA
Download sequence
Identical sequences A0A0J9QYG1 Q9VLQ9
FBpp0079247 NP_609199.1.81976 XP_016024113.1.80810 7227.FBpp0079247 FBpp0079247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]