SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079596 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079596
Domain Number 1 Region: 85-388
Classification Level Classification E-value
Superfamily L domain-like 9.69e-43
Family Internalin LRR domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079596   Gene: FBgn0032235   Transcript: FBtr0080006
Sequence length 491
Comment pep:known chromosome:BDGP5:2L:10382263:10384723:1 gene:FBgn0032235 transcript:FBtr0080006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLTKSATLAAAIFCIVLSQVSGQTKDETTTTETPKEKIKVIDSKLCKKCNCYIDTNLLD
CSEKLQDWLSAEDWEDLTNGNVVFKTINLEHNNLTSVPILPKYDVENLYLANNQIDSISV
GAFQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFESLENLKTLNLGYNDLHSLDAD
LFEHIPHIEELVLCSNSFHVIDQLSETAISGLQSLKILDVSYMEIDDLPDTILHGPRDLE
IFIAAGNLFNQLPKALKYATNLTSLVLNENPIENLIGDNVFPPLTKLTHLSMTFMSKLYK
IGPGAFSELQSLTELILSDNKLLNEIDEEALSKNVTGGQYLDYPPLEKVYLNNCNVSTLP
KELLVRWDKLKALDLRFNPWNCDESNDFLINVLIDRINKTTPVLAKDVKCGGPNKLNDVT
LLRVANEHMIESSTGSLIWVGLLVVLLIAVPTIIGAYVMKRRGCFGVFRRHDSGASSALY
NRTSFNEDFHI
Download sequence
Identical sequences Q9VKX6
FBpp0079596 NP_723576.1.81976 7227.FBpp0079596 FBpp0079596 FBpp0111947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]