SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079699 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0079699
Domain Number - Region: 129-169
Classification Level Classification E-value
Superfamily RING/U-box 0.0192
Family RING finger domain, C3HC4 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079699   Gene: FBgn0032290   Transcript: FBtr0080110
Sequence length 299
Comment pep:known chromosome:BDGP5:2L:10728975:10730302:1 gene:FBgn0032290 transcript:FBtr0080110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCDGGTIPRRDELVRVKQKPEQKDKDAEREFRWRHCTLTQQSLQEPIAMCGMGRLYSKQ
SVIERLLEKEPMPETAAHVKSMKDIRQLNPTPNPAFTEEDKTEGLLDTRHSPYICKLIGL
EMSGKFRFVALWSCGCVLSERALKQIKGSVASTCPLCQAAYSVEDVVVLNGNEEDMELMR
VKMEMRAAKRKSSKKDKKSAKKVEVKAEPAEEQEPVASTSKAAAAEKPTTSTKTKAVAPV
KRLGAVNAMQDPELKRLKSDFSVAKDPKASDVYKSLFTSHKTEKDQERAHWVTYNPFYN
Download sequence
Identical sequences Q9VKR2
FBpp0079699 FBpp0079699 7227.FBpp0079699 NP_609443.1.81976 FBpp0079699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]