SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079836 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079836
Domain Number 1 Region: 28-259
Classification Level Classification E-value
Superfamily L domain-like 3.61e-41
Family Ngr ectodomain-like 0.0027
Further Details:      
 
Domain Number 2 Region: 258-367
Classification Level Classification E-value
Superfamily Immunoglobulin 9.31e-16
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079836   Gene: FBgn0015400   Transcript: FBtr0080252
Sequence length 894
Comment pep:known chromosome:BDGP5:2L:11606514:11626124:1 gene:FBgn0015400 transcript:FBtr0080252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLPIWIPLLALLAITAACPPEVCVCKWKGGKQTVECGGQQLSNLPEGMDPGTQVLNFS
GNALQVLQSERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSENALQNVPSE
TFQDYSSLMRLSLSGNPIRELKTSAFRHLSFLTTLELSNCQVERIENEAFVGMDNLEWLR
LDGNRIGFIQGTHILPKSLHGISLHSNRWNCDCRLLDIHFWLVNYNTPLAEEPKCMEPAR
LKGQVIKSLQREQLACLPEVSPQSSYTEVSEGRNMSITCLVRAIPEPKVLWLFNGQVMSN
DSLMDNLHMYYYIDETIGVSGAEEKRSEIFIYNVGAEDNGTFSCVGQNIAGTTFSNYTLR
VIIKEPPVVNEVSFPRDYMNYIVASSAGGGIIFVVLLCTIVVKCKKTSEPAKQRKKCDQV
TSIAGGTDSSTGSTQDTGMGMMKCASILNDGGDSMNGNPGLLLGDTLTPTKAANGAAGGG
IILGNQMKQNLLLYATPNSAQQQLQLNVNLMGTGPGSPPLLLSNGHGLAAAYCSPPASLR
NYQEKNPDLVNDAESVKHKLKTAVSLDGAGEYETQSDCGQYEGCYQLAAAPHPHQGHQHP
HPGHPLMGRFAQAMTTLPRGMQLKPAPHQVDVHLNPVCFLGQDGSFAYDYSSAHMVQQPP
QQQQQQQQVQPANNFYRTLPHNRLHKQQQFQAAAAAGGNVGVGGNPTLRYSLEAEFIQRG
PTVSYEKYQLPNVRFTAEGYPQQQQQQQQQLQQQQQLQLQQQHQFPSPPEGYKSDLAVMP
APFQQWPSCLPGYRFAQSPTSLPAVATPPPAAVVATPPPPTSAVSTQSTATSTIPELDES
EASSPRLEEAAGSAAPPAGEEESSDTAKLKQLNGPLADSPDEGYVGDGQETSDI
Download sequence
Identical sequences Q9VKG1
NP_523551.1.81976 FBpp0079836 7227.FBpp0079836 FBpp0079836 FBpp0079836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]