SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079899 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0079899
Domain Number - Region: 2-22
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000706
Family CCCH zinc finger 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079899   Gene: FBgn0042127   Transcript: FBtr0080315
Sequence length 398
Comment pep:known chromosome:BDGP5:2L:11993989:11995428:-1 gene:FBgn0042127 transcript:FBtr0080315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVCRFFQQGSCRYGAKCNNEHFDVKQYLKADMESSLNGKMWPLSAYGPFKDKANFPNFI
QDQSFEEVRFMCYEAKRQNQFEQFSQQFNREVLEANNKMKTMLQMSPQVLEMMIKIHETP
EGGTVSAAPQQSSNPFAAAAPAAANTSASIFGKPTLSAGNIFGNATSQASNTNSIFGGTI
SNANARNSIFGVGAAATGAQSVFGQPQQQQLQPAAQAFQGGNIFAQAQVQVQAQPVNPNP
FGGFQQQQQQPQSTGIFGQAASQNMGGMFTQASQQLQQQQQAAASGLFAQAAASAFPNQQ
QMQQQQQMQQQQQMQQQQMHQQQQMQQQQMQQQQQQFQMQQQQQMMQQQQQQAQPTNEIQ
SSVYSRMEDLNEQEIEAFKADQFLPGALPFKPPPRNFC
Download sequence
Identical sequences Q9I7N3
FBpp0079899 NP_723704.1.81976 FBpp0079899 7227.FBpp0079899 FBpp0079899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]