SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079915 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079915
Domain Number 1 Region: 291-572
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.01e-91
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000941
Further Details:      
 
Domain Number 2 Region: 114-289
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.09e-53
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000686
Further Details:      
 
Domain Number 3 Region: 574-682
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.72e-29
Family Anticodon-binding domain of Class II aaRS 0.00093
Further Details:      
 
Domain Number 4 Region: 52-112
Classification Level Classification E-value
Superfamily TGS-like 0.000000000000017
Family TGS domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079915   Gene: FBgn0027081   Transcript: FBtr0080333
Sequence length 690
Comment pep:known chromosome:BDGP5:2L:12104283:12106894:1 gene:FBgn0027081 transcript:FBtr0080333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKEKKEKPSGGGDTRKELSPLPKYIEERNVFWEKCKAEYEAELAAKKREPIKVTLPDGK
QVDATSWETTPYEVARGISQGLADNTVISKVNGEVWDLDRVLEGNCTLQLLKFDDPEAQA
VFWHSSAHIMGEAMERIYGGHLCYGPPIENGFYYDMHLEGEGISTNDYGAMEGLVKQIVK
EKQNFERLEMKKSDLLEMFKYNEFKVRILNEKVTTDRTTVYKCGSLIDLCRGPHVRHTGK
VKALKITKNSSTYWEGKADAETLQRVYGISFPDPKQLKEWEKLQEEAAKRDHRKIGREQE
LFFFHELSPGSCFFQPRGAHIYNTLMGFIKAEYRKRGFQEVISPNIYNAKLWMTSGHWQH
YAENMFSFEAEKEKFALKPMNCPGHCLIFDNRNRSWRELPLRMADFGVLHRNELSGALTG
LTRVRRFQQDDAHIFCAPEQIKSEMKGCLEFLKYVYTIFGFSFQLVLSTRPDNYLGELEQ
WNDAEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRF
NLSYIADDGEKKRPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQ
YAQSVRDQLHDAGFMSEADCDAGDTMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRD
NKVHGEVSVAELITKLQKIRDEFIANEDSF
Download sequence
Identical sequences Q8IP94
NP_524839.3.81976 NP_723726.1.81976 FBpp0079913 FBpp0079915 7297921___KOG1637 FBpp0079913 FBpp0079915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]