SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079948 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0079948
Domain Number - Region: 12-207
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00023
Family BAR domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079948   Gene: FBgn0032428   Transcript: FBtr0080366
Sequence length 395
Comment pep:known chromosome:BDGP5:2L:12424904:12426440:1 gene:FBgn0032428 transcript:FBtr0080366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRRGKLSFLNTKDDRVKIINERINITERHLMEMCSSFALVTRKMAKYRDSFDELAKSVK
SYADDEEINESLCQGLKSFTNAVTIMGDYMDINVHRLEHKIVNELAQFEQLCKSTRDNLR
LAVIARDKEVLRQRQMLELKSKFSANNSAADSELFKAKMEVQRTNKEIDDIIGNFEQRKL
RDLKQIISDFILIAMKQHTKALEILSASYYDIGTIDERDDFIEFQKLMKTKEELASRKTA
LKKGLRSQSMDSLEHEHLVSPLKRRPKLSRSNRNLTGAGINHGSKTEPEDETDEQDEEED
DEDEETEQSGEEDEESGTATDDEREPTQPGNQVPPRENVFGAKIRSASKDIATPSTSASA
TSAPSKPSRQTVKHPFKAVASTHVRLQKQFHVPQH
Download sequence
Identical sequences Q9VK91
FBpp0079948 7227.FBpp0079948 NP_609564.1.81976 FBpp0079948 FBpp0079948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]