SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080025 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080025
Domain Number 1 Region: 12-67
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000335
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080025   Gene: FBgn0032488   Transcript: FBtr0080445
Sequence length 455
Comment pep:known chromosome:BDGP5:2L:13222561:13224550:1 gene:FBgn0032488 transcript:FBtr0080445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKSSAARWVKFFNAAGIPSPAAAGYAHVFVENRIQDDMLLDLNKEYLREMGITLMGDII
AILRHSKTVCEQNAREQVLTTEVVQSVVRPVSPKPKAPVATPKAKVYPPAKPARRVLPEH
EGKYKVTLPSGTTERSKQILAKREKLYSDRVSSSKKSDIFTRLHAEDEAQEGIVSSSGES
SVRVHVAGASKTAATSSNNSVFARLGGKQGALPEEFTSTREIKSILKNTHRTVGGGGGGG
GVTKNSPIVKAKKVAAVTQQKVMLVHKVPLKKGDDDDDSMDDFESDEEDYMSSGEDFDMG
AGEKIVKFASTAEVREIVPESAYKNRQGKSFANNIKSRLGMVSKLHATKKTYNLKASPAR
KPQARLSPVKGKTIRMRSDELFSRQDTVPVHRRLGKTATSAPLRAPPAPPHRQPRPEPQK
KYVPPRRHNSMNAGHSRQRDQSGSVFDRLGFNNSM
Download sequence
Identical sequences Q9VK18
7227.FBpp0080025 FBpp0080025 FBpp0080025 NP_609619.1.81976 FBpp0080025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]