SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080064 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080064
Domain Number 1 Region: 46-282
Classification Level Classification E-value
Superfamily L domain-like 3.63e-35
Family Ngr ectodomain-like 0.0042
Further Details:      
 
Domain Number 2 Region: 277-390
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000453
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080064   Gene: FBgn0032484   Transcript: FBtr0080485
Sequence length 649
Comment pep:known chromosome:BDGP5:2L:13212335:13215152:-1 gene:FBgn0032484 transcript:FBtr0080485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIKLSFDPCSISLKHLSLFLFKIYCLALIFRSASADWLLDCGNCHCKWNSGKKTADCRN
LSLSGVPEYLSPEVQVLDLSHNHIFYLEENAFLTTHLQNLQKLLIRNGTLKYLNQRSFTQ
LQILIELDLSNNLLVDLLPNVFDCLSKVRAIFLNGNLLQALRHGVFRNLKYLHKIELKRN
RLVSIDAKAFVGVPLLSQIYLDNNELTKLRVESFQDLTKLTALSLVENPWNCTCDLQMFR
DFVIGMNLYTPPTSCHYPLQLRGRLWIEDQPEAFACKPKIVYPTLSTSINTSKENVTLIC
RVHGSPNTVIAWDYTNQVYESRSKPVKSLQKQRIYIELLREDESKIRKFGHDVFVSRLTI
VNARKSDEGVYTCLAENPGGKDSVHISVVVQKDMERISLIDSNFFAIVCLIAMGFLSMSI
LFSLVTCLIFKRFKQFHPGQHTYLQPTSLPVQSPGSEEATAISALSSGVIRESKIVLDPL
SAINEPSNKNYTLFKTSNSNGSEYMHTRNYKDVRLNSNTYTENLDNQAESISSRNRELYS
NIAGDREKEELKQKDELDKDSRQSSLQSTGCSRKKGQIDELQPDLLPSTQPTALKNINET
FGPSAKKAEVNPRSKYNTNVQKYLKEKYGSVRIKNISTKEPITGVDISI
Download sequence
Identical sequences Q9VK22
7227.FBpp0080064 FBpp0080064 NP_001260435.1.81976 NP_001260436.1.81976 NP_609615.2.81976 FBpp0080064 FBpp0080064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]