SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080069 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080069
Domain Number 1 Region: 526-627
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.27e-34
Family MBT repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 439-566
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.51e-32
Family MBT repeat 0.0016
Further Details:      
 
Domain Number 3 Region: 207-323
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.32e-26
Family MBT repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 304-404
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.77e-26
Family MBT repeat 0.00074
Further Details:      
 
Domain Number 5 Region: 785-853
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000299
Family SAM (sterile alpha motif) domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080069   Gene: FBgn0032475   Transcript: FBtr0080491
Sequence length 868
Comment pep:known chromosome:BDGP5:2L:13169649:13176785:-1 gene:FBgn0032475 transcript:FBtr0080491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACARGELYSLVLNTKMEGDQATTSSPDPGAGSESADLPGDQQQSQSDIELDLHAAHIKN
ANYRFRITDQSKITQLNSFGEPMSMGGDAAANNVQMAADETIAALNGGAVGDATAPGSTE
EGASTPNSYLSAAPTPKALRLFKDIYPQDDLPQIPKYERLPVPCPQMEKIISIRRRMYDP
THSYDWLPRLSKENFNAAPVTCFPHAPGCEVWDNLGVGMKVEVENTDCDSIEVIQPGQTP
TSFWVATILEIKGYKALMSYEGFDTDSHDFWVNLCNAEVHSVGWCATRGKPLIPPRTIEH
KYKDWKDFLVGRLSGARTLPSNFYNKINDSLQSRFRLGLNLECVDKDRISQVRLATVTKI
VGKRLFLRYFDSDDGFWCHEDSPIIHPVGWATTVGHNLAAPQDYLERMLAGREAMIEVHE
DDATIELFKMNFTFDEYYSDGKTNSFVEGMKLEAVDPLNLSSICPATVMAVLKFGYMMIR
IDSYQPDASGSDWFCYHEKSPCIFPAGFCSVNNISVTPPNGYDSRTFTWEGYLRDTGAVA
AGQHLFHRIIPDHGFEVGMSLECADLMDPRLVCVATVARVVGRLLKVHFDGWTDEYDQWL
DCESADIYPVGWCVLVNHKLEGPPRVAHQQAPKPAPKPKIQRKRKPKKGAAGGKTPTDNN
TQSVKSRTIALKTTPHLPKLSIKLELKPEHHNAAFYENNQPEEEGDEEDPDADGDGDGST
SHISEQSTTQSSSDLIAGSGSGSGSASLVTLATGSNKTNSSATNNKYIPRLADIDSSEPH
LELVPDTWNVYDVSQFLRVNDCTAHCDTFSRNKIDGKRLLQLTKDDIMPLLGMKVGPALK
ISDLIAQLKCKVNPGRARSHKTNKSPFL
Download sequence
Identical sequences FBpp0080069 NP_723786.1.81976 FBpp0080069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]