SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080070 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080070
Domain Number 1 Region: 878-979
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.28e-34
Family MBT repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 792-918
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.52e-32
Family MBT repeat 0.0016
Further Details:      
 
Domain Number 3 Region: 559-675
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.84e-26
Family MBT repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 656-756
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.78e-26
Family MBT repeat 0.00074
Further Details:      
 
Domain Number 5 Region: 1137-1205
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000464
Family SAM (sterile alpha motif) domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080070   Gene: FBgn0032475   Transcript: FBtr0080492
Sequence length 1220
Comment pep:known chromosome:BDGP5:2L:13169649:13176785:-1 gene:FBgn0032475 transcript:FBtr0080492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPSELRMMWMSSQYNSERITLEDAATLLGHPTVGLSVMEDLSAHQPTLDMNPMMSLMGG
DFTGQAAATAAALGVQPGTLIATNSNNLYGFAHMGGLQQQLLQQSAAAAVFQNYAEAMDN
DVENGMVGMAMEAVVDDDDQVYGQRDNNFDDNGSELEPKQEIINIDDFVMMNEDNNSYDG
TDFMTSSDKDISQSSSSCMAQMPGSLGVPGVEHDLLVPLPDGLLHHKLLGTTLVPAMGTL
NGNAFGNIMVSTENTSSKQMQRTYSTAKGANSTATTATCSASTSSALRSQRKTRKIEPVN
RPGLVLKTPIAYRGNIDPSVIPIQKDGMAVCKRCGAIGVKHTFYTKSRRFCSMACARGEL
YSLVLNTKMEGDQATTSSPDPGAGSESADLPGDQQQSQSDIELDLHAAHIKNANYRFRIT
DQSKITQLNSFGEPMSMGGDAAANNVQMAADETIAALNGGAVGDATAPGSTEEGASTPNS
YLSAAPTPKALRLFKDIYPQDDLPQIPKYERLPVPCPQMEKIISIRRRMYDPTHSYDWLP
RLSKENFNAAPVTCFPHAPGCEVWDNLGVGMKVEVENTDCDSIEVIQPGQTPTSFWVATI
LEIKGYKALMSYEGFDTDSHDFWVNLCNAEVHSVGWCATRGKPLIPPRTIEHKYKDWKDF
LVGRLSGARTLPSNFYNKINDSLQSRFRLGLNLECVDKDRISQVRLATVTKIVGKRLFLR
YFDSDDGFWCHEDSPIIHPVGWATTVGHNLAAPQDYLERMLAGREAMIEVHEDDATIELF
KMNFTFDEYYSDGKTNSFVEGMKLEAVDPLNLSSICPATVMAVLKFGYMMIRIDSYQPDA
SGSDWFCYHEKSPCIFPAGFCSVNNISVTPPNGYDSRTFTWEGYLRDTGAVAAGQHLFHR
IIPDHGFEVGMSLECADLMDPRLVCVATVARVVGRLLKVHFDGWTDEYDQWLDCESADIY
PVGWCVLVNHKLEGPPRVAHQQAPKPAPKPKIQRKRKPKKGAAGGKTPTDNNTQSVKSRT
IALKTTPHLPKLSIKLELKPEHHNAAFYENNQPEEEGDEEDPDADGDGDGSTSHISEQST
TQSSSDLIAGSGSGSGSASLVTLATGSNKTNSSATNNKYIPRLADIDSSEPHLELVPDTW
NVYDVSQFLRVNDCTAHCDTFSRNKIDGKRLLQLTKDDIMPLLGMKVGPALKISDLIAQL
KCKVNPGRARSHKTNKSPFL
Download sequence
Identical sequences M9PFS7 Q9VK33
FBpp0080070 FBpp0305438 NP_001260432.1.81976 NP_609606.2.81976 FBpp0080070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]