SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080080 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080080
Domain Number 1 Region: 633-782
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.96e-40
Family Toll/Interleukin receptor TIR domain 0.00019
Further Details:      
 
Domain Number 2 Region: 174-382,459-572
Classification Level Classification E-value
Superfamily L domain-like 1.87e-32
Family Ngr ectodomain-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080080   Gene: FBgn0026760   Transcript: FBtr0080502
Sequence length 795
Comment pep:known chromosome:BDGP5:2L:13435622:13439333:1 gene:FBgn0026760 transcript:FBtr0080502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTYLPVVWLFFALLVLRSATGQIIPLPTFCLGLSPQCTCAAEGNVVRFHCPDEYAMLLE
VSEPGASLYMSYYASTELQWLPRFNISSLVKIEFDAYIFWPEKFLSDLLKTLGVQTVKTI
IFRDRTLETVVTRDVLNSGNGYMETSQPENITTWHFGSVPGLKKFKFFSHVPELQESIFH
GFDTLRDLHLSVNVTTLPGNMLSTVNGTLKTLTIESPGIVSFGNPLLRELQQLRNLSLAL
IHPFHERDKQLQPHFFGSMTNLEEVRLASATSSVNRSMFKGTNKLQLIKMNGNDDLMELP
GEIFLDQVNLKTLDLSCNAIVTLHEDVFKGLGNLTLLDLSKNRLTNLSSTIFAPLTSLNV
LRLNKNSLTAMSPSVFQDVVSLNYIEMVNTQFYGATLLMNYEAVVCTNDEACQYKSAEWQ
CDPRCICWVQRSVGSLIVDCRGTSLEELPDLPRTTLLSTVLKVGNNSLTSLPTVSEHSGY
ANVSGLFLSDNNLTSLGSGDQLPDNLTHLDVRGNQIQSLSDEFLLFLQEPNNTMTLSLSG
NPITCGCESLSLLFFVRTNPQRVRDIADIVCTKQKKSFQQMEAFELCPSYVLLISCVVGG
LVIVICLLTVFYLMFQQELKIWLYNNNLCLWWVSEEELDKDKTYDAFISYSHKDEELISK
LLPKLESGPHPFRLCLHDRDWLVGDCIPEQIVRTVDDSKRVIIVLSQHFIDSVWARMEFR
IAYQATLQDKRKRIIIILYRELEHMNGIDSELRAYLKLNTYLKWGDPLFWSKLYYAMPHN
RRVLKGQKKHAGPLI
Download sequence
Identical sequences Q9VJX9
7227.FBpp0080080 FBpp0080080 FBpp0080080 FBpp0080080 NP_001285901.1.81976 NP_477438.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]