SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080089 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080089
Domain Number 1 Region: 29-232
Classification Level Classification E-value
Superfamily L domain-like 4.17e-41
Family Ngr ectodomain-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080089   Gene: FBgn0028546   Transcript: FBtr0080511
Sequence length 283
Comment pep:known chromosome:BDGP5:2L:13639519:13642360:-1 gene:FBgn0028546 transcript:FBtr0080511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQSCIPVSAKMSKAKKVLDEARETHNPELDLADKGLSSFEELPGLFNMSNITRLTLSHN
KISVISPGIANLLNLEILNLSNNQLTELPVSLSSMPKLRILNVSINRLINLPRGFGAFPV
LEVLDLSYNNLNEQVLPGNFFGMETLRALYLGDNDFEYIPKEVGQLKNLQILGLRDNDLL
ELPREVGDLVRLRELHIQNNRLQVLPPEIAQLDLLSNKSVMKMEENPWVNPIAEQYLLGI
SHVIDYLKTETYKIIYNRHLQAGRSGPPPPKADKSKKASRIRA
Download sequence
Identical sequences Q9V428
FBpp0080089 FBpp0080089 FBpp0080089 NP_001285902.1.81976 NP_001285903.1.81976 NP_609665.2.81976 7227.FBpp0080089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]