SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080180 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080180
Domain Number 1 Region: 13-324
Classification Level Classification E-value
Superfamily L domain-like 1.36e-48
Family Ngr ectodomain-like 0.065
Further Details:      
 
Domain Number 2 Region: 295-420
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000385
Family Ngr ectodomain-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080180   Gene: FBgn0028872   Transcript: FBtr0080606
Sequence length 548
Comment pep:known chromosome:BDGP5:2L:14029262:14031539:-1 gene:FBgn0028872 transcript:FBtr0080606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLLPGSLLLLIFSFSPRLSCLQLSKCNNTEVTLIRKTELLTSLTLSNCTLPHVENGFFV
RFDHLLHLELQHSGLSDLDDFSLNGLTKLQYLSLSHNNLSSLRSWSSEPLGALTNLDLSH
NMLSKLSVKSFEQYPQLQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFR
GLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQRGLARLVHLNLSS
NLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLD
SLIALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEISSQMMFNQNHLRYIKLSG
NAISDAAFLDRLSPSVNRFTLYVDLSSNRLKSLNLSSLLHFRYINLADNNWSCNWLVANL
VQKLPNSVNFARPWTVINNLSENTTNVEGIDCIEGGTNRSIILLDVSGVPQPKSDNCDCV
VAYDETNPSPPPLTWPKIPTDRFDSRSVIIWMLVAIAIAFSGLRWLRRFVDRNEKRKLGQ
KMLHNVVC
Download sequence
Identical sequences Q9VJU1
FBpp0080180 NP_001285924.1.81976 NP_609697.2.81976 FBpp0080180 7227.FBpp0080180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]