SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080183 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080183
Domain Number 1 Region: 745-1035
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.19e-52
Family Rhodopsin-like 0.0011
Further Details:      
 
Domain Number 2 Region: 149-455
Classification Level Classification E-value
Superfamily L domain-like 1.56e-51
Family Ngr ectodomain-like 0.036
Further Details:      
 
Domain Number 3 Region: 367-619
Classification Level Classification E-value
Superfamily L domain-like 2.18e-41
Family Ngr ectodomain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080183   Gene: FBgn0003255   Transcript: FBtr0080610
Sequence length 1360
Comment pep:known chromosome:BDGP5:2L:13982726:14001252:-1 gene:FBgn0003255 transcript:FBtr0080610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARCRWSWRLALCPLLLQLLLQLLLLPPSAMGHDETKENPAPDMQNSQEQEPYVHLQHL
QQQQQQNPQTVQQLSQITVNRTSKSASVTPTGIRENVMLPSADPEKEAQILYEKSLQEYH
GSQLSTASTATDVIAGKRTLHSICERWLQKHCHCTGSLEVLRLSCRGIGILAVPVNLPNE
VVVLDLGNNNLTKLEANSFFMAPNLEELTLSDNSIINMDPNAFYGLAKLKRLSLQNCGLK
SLPPQSFQGLAQLTSLQLNGNALVSLDGDCLGHLQKLRTLRLEGNLFYRIPTNALAGLRT
LEALNLGSNLLTIINDEDFPRMPNLIVLLLKRNQIMKISAGALKNLTALKVLELDDNLIS
SLPEGLSKLSQLQELSITSNRLRWINDTELPRSMQMLDMRANPLSTISPGAFRGMSKLRK
LILSDVRTLRSFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSLKRIPN
LSSCRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDL
EGNEISYIHKEAFSGFTALEDLNLGNNIFPELPESGLRALLHLKTFNNPKLREFPPPDTF
PRIQTLILSYAYHCCAFLPLVAMSSQKKTSQVQEAVLFPSDAEFDMTLWNNSMMNIWPQM
HNLSKQLGASMHDPWETAINFNEEQLQTQTGGQIATSYMEEYFEEHDVSGPATGYGFGTG
LFSGMSTEDFQPGSVQCLPMPGPFLPCADLFDWWTLRCGVWVVFLLSLLGNGTVVFVLLC
SRSKMDVPRFLVCNLAAADFFMGIYLGILAIVDAATLGEFRMFAIPWQMSVLCQLSGFLA
VLSSELSVYTLAVITLERNYAITHAIHLNKRLSLKQAGYIMSVGWVFALIMALMPLVGVS
DYRKFAVCLPFETTTGPASLTYVISLMFINGCAFLTLMGCYLKMYWAIRGSQAWNTNDSR
IAKRMALLVFTDFLCWSPIAFFSITAIFGLQLISLEQAKIFTVFVLPLNSCCNPFLYAIM
TKQFKKDCVTLCKHFEESRVVGGGGPGGRGAVARTKRGDLPPPLLPAAAVAHPPGCRCLR
MLPSEMPNWHKMEQTPSMWQRLRTFCCGENRRRRKQRRQPQQRRQRAYTAAAANPYQYQF
AELRQQRQNRASSISSENFCSSRSSSWRHGPPSSAPVPPGNCSMPLKMLEPHAHPHGHGR
RRHSAWLITRKTSQDSNLSSSRNDSSASATTASTSTFRLSRSSAGSSTPLPSIIAHNGKA
QLDAVKPRLVRQEAVQEEEDSSPPRLGVRFLPTIPSAADSSVVMEDGDSANTGVASFLGM
PLPGASSGFLIAPTTAATTSPPPVVLQPAKPPPDPNDAPL
Download sequence
Identical sequences Q7KTA0
FBpp0080183 FBpp0080183 NP_476702.1.81976 FBpp0080183 7227.FBpp0080184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]