SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080198 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080198
Domain Number 1 Region: 4-66
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000436
Family ZZ domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080198   Gene: FBgn0028531   Transcript: FBtr0080625
Sequence length 511
Comment pep:known chromosome:BDGP5:2L:14338240:14340080:1 gene:FBgn0028531 transcript:FBtr0080625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMNRHERIECKGCGKRSLTFRCYRCLSCQDFDICEECYDNDFTTSTHPFDHPVVCVLIP
ADVELYFGGEYISNYPPQSYRCPYCKRWGFNESTFLEHVSAMHPDASPLLVSTMVGLFEQ
QQAARLFLENEQLASIAVAATSRNELMRRPEGSMALYLEPLNRDGSYRRVVERNNEDRSR
RLSPDGRDRLQALVRERYSRIARRSAARVGNMTSRPLLAPAPGDGSRLSGIQESIEAGQG
IRNVIVEELSTSNYDPPFTINASASAILEQQQQQQVMGPSPNAAAPPIVTHPSLIEMMRF
YDEAGLQPFPASSRRVIRTRHANPAQPAANIGNNTRSINVYGPTSAFTQASHNTRSLTAP
DLFSLDERYRISRMPMFQANPGALHRQGTGTRALDTRAVEFSEFPPEETELPLILGTSTI
EDPSKLTKQRDQERRRFLCYRFTTPRSSKRPQNHFLLQRAEFVSQVLYSALCDEDFQDIS
FPILRNIPKLRTIPDNVISGAGDAEKNPSNP
Download sequence
Identical sequences Q9VJT3
FBpp0080198 7227.FBpp0080198 FBpp0080198 NP_001285929.1.81976 NP_609706.2.81976 FBpp0080198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]