SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080314 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080314
Domain Number 1 Region: 42-233
Classification Level Classification E-value
Superfamily L domain-like 2.72e-34
Family Ngr ectodomain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080314   Gene: FBgn0028518   Transcript: FBtr0080755
Sequence length 550
Comment pep:known chromosome:BDGP5:2L:15630084:15632618:1 gene:FBgn0028518 transcript:FBtr0080755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQCVTKPKMWLGLKQILLYVGLLLCVLLQVCRSKTQSQMFCPTVCHCDLHAQRNRAVC
SAKRLISANIEIPTTVELLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVE
LTRLRYLDLSYNRLEQIDEHILESNNQLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRNS
QVNQLGTQLLSALPQLRQLDLAQNLLLTLSPGDFHAPRNLASLNVEENPFNCDRALAKVA
TGLRQRGVAIFMSNCMEEEVQDHQDDAEAVNFPNKNEKFESMEYLEPSTRGPQSVLSVWR
DLDSSEEQNSSQDDEQMSSLSDVCEGSREKLCLRYRICLERVSHELLAGGNSQLEDEIIR
THTYDEDDLKLAFVVGGATGVCMVIFIITFALCLKSCCEMRKKKSNPEVATGVSAPLNPS
QDSLPTIHTWSPQRTRNPRRSNPQRPRSTQSHAVVRQPYGPQDNFVSRLFGRPARSQYYR
TINQNTATLIRRLSRSNLFTSRDREPSSPAEPPTSTARFYTDVIESGAIRPETPPPNYGD
VVVIENCDNK
Download sequence
Identical sequences Q9VJN8
FBpp0080314 7227.FBpp0080314 NP_001285960.1.81976 NP_001285961.1.81976 NP_609761.1.81976 FBpp0080314 FBpp0080314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]