SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080385 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080385
Domain Number 1 Region: 93-146
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000589
Family RING finger domain, C3HC4 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080385   Gene: FBgn0028896   Transcript: FBtr0080827
Sequence length 162
Comment pep:known chromosome:BDGP5:2L:16291284:16291948:1 gene:FBgn0028896 transcript:FBtr0080827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKIEKELERTEQQQQEPTEPSNGNLEEQVRKLRDHNLRVKHLNTQRRRILRLLQGKMLQ
YATLEERLHRIGELVLIAELHSGVKTLNQRLDRMVENSTCSICLLPWTDNGIHRLVSLRC
GHLFGSSCIHMAIRRNHRCPICRRRARHFHVRRIYSPSFLSH
Download sequence
Identical sequences Q9V3Z8
FBpp0080385 FBpp0080385 7227.FBpp0080385 NP_609784.2.81976 FBpp0080385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]