SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080437 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080437
Domain Number 1 Region: 143-357
Classification Level Classification E-value
Superfamily L domain-like 7.03e-20
Family Ngr ectodomain-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080437   Gene: FBgn0028523   Transcript: FBtr0080880
Sequence length 455
Comment pep:known chromosome:BDGP5:2L:16400169:16448465:-1 gene:FBgn0028523 transcript:FBtr0080880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWLLLLLSLIAPSWQENATVINPSYVTKAGCEALVKEPNLCECQEQEIKCENLQLHSDN
LQLYGISCSIFDARGFGYIPPLKVGNIGSLIVQNCAIPNAESIKYLLSKLGVSNYTELEI
FNYFDPKKTDRGEVLQQHYTDHESLKKVSIIGFKSTLPENFLENLPALQQLSLKGSSDLP
GNILHPLKNLTHLEIVVKNLGKVSGAIFAKQSKLKHLMIDCDAKNSSVEMSAFGPQELWH
MTELQSIELFNCGDNVPTELFWMSEQLAYIGIRSNISYLSKDFLKVQKKLLTLRLERNNI
ARLPDQLFRNTPLILEIHLAFNNLDRIQSGLFDKLKNLQVLNLEHNPITTIALNAFTPIP
TAHIYVGKLFKAAKNADWARSTNATICEEEYIYGVCIYCKRDEYLDHFADSENCNKPNPK
AKDVLAKKAYENQLKAMPTHSWKKAKEYPVEEEQP
Download sequence
Identical sequences Q7KT58
FBpp0080437 FBpp0080437 FBpp0080437 NP_001285981.1.81976 NP_609794.1.81976 7227.FBpp0080437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]