SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080497 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080497
Domain Number 1 Region: 95-144
Classification Level Classification E-value
Superfamily RING/U-box 1.08e-16
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080497   Gene: FBgn0051807   Transcript: FBtr0080944
Sequence length 155
Comment pep:known chromosome:BDGP5:2L:16681691:16682402:-1 gene:FBgn0051807 transcript:FBtr0080944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNNKAQTRSLMRMLKKDVVEQLLAERKKSEQKDKQLAKLNITTQEKDKMREEELKLYYQ
MEEEITNQKLLQEQLLFESKDELTQQLEKIAIENTCCICLDPWEAKDHHRLVSLRCGHLF
GEMCIRTHLQHADMCPICRKVAIERDVWRVLLNTP
Download sequence
Identical sequences Q8IP15
7227.FBpp0080497 FBpp0080497 FBpp0080497 NP_723984.1.81976 FBpp0080497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]