SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080521 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080521
Domain Number 1 Region: 55-281
Classification Level Classification E-value
Superfamily L domain-like 8.5e-36
Family Leucine rich effector protein YopM 0.05
Further Details:      
 
Domain Number 2 Region: 662-775
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-26
Family Calponin-homology domain, CH-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080521   Gene: FBgn0032633   Transcript: FBtr0080968
Sequence length 809
Comment pep:known chromosome:BDGP5:2L:17367509:17384147:-1 gene:FBgn0032633 transcript:FBtr0080968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATVYQRLHSVAVGVGSAAGSAIGSGSASLPGSGTGSGSGIGHAGNTSSSTSSALLSHS
QLTRSLERILEEAHFSGELILTNRKLKDFPRTGTKYSLTDTVIADLSRNRFAELPEEVTT
FAFLETLLLYHNTIRSIPESVKQLSSLTYLDLRSNQLSSLPREICFLPLQVLLVSNNRLT
SLPDELGRLDQTLTDLDASYNQLANLPARLGELRSLRSLSLRSNHLLYLPRELTCLSLIS
LDVSNNKIASLPLEIRHMSTLVELQLENNPLTSPPASLCMRGLVHVFKFLETQATKDEKG
SRSGGNYDGYTTLRRAPRHNSSGNVLEASTTGSTNNQRRHQVDSGYNTSDGLDKRWSHDA
PTKSKTDSPLHCVSNSTAATLPRTLPSAVHSQADLMDASLTSSTSTIVDESLTLSPTASP
CKLSYAHSNSSSNGSSPDQDDDIMLDHQERTVHHANGRSGKGLGNIQTYKEYKEALKQQR
NQEISVYKQKHPNANHSPNDDEDLSPSPPSISNGSSSNTLPKSIMKQNSNQIGHNGNGNG
SANGNGVDDVVIPKKPIQKVIPSRITEIKPASTSDIRSANSSDCLGYVKPQSPMKNGTSK
FNTSNGGGVQTTVGIVSSTTIKSPVSSTTKLGTVKTHRSVTWNHDIPAEKLSFTMRREFD
RQREETELMSQLRTIIETRLKMTLPVDIASALTDGVILCHLANYVRPRSVASIHVPSPGV
NKLTMARCRRNVDNFLEACRRIGVDENLICCAADVLEGKGAVQVAITVGELFRLHGNGGC
GSGNSSGAATPTKSPTRTTRATMSPTPLA
Download sequence
Identical sequences Q960C5
FBpp0080521 NP_724046.1.81976 FBpp0080521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]