SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080582 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080582
Domain Number 1 Region: 52-467
Classification Level Classification E-value
Superfamily L domain-like 1.19e-56
Family Ngr ectodomain-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080582   Gene: FBgn0243486   Transcript: FBtr0081029
Sequence length 741
Comment pep:known chromosome:BDGP5:2L:18012407:18070249:1 gene:FBgn0243486 transcript:FBtr0081029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFKWLLFSLCIMPAMFSNTKRKCPTECQCSMDDLDRYQAICTKGGLNSLLSPNELDVDV
KVIIIRGPRNSITIGPALRQFMKLEILRITDSNLPAIGAESFWGLKYLRILDLSKNNITN
ITENNFRGQDNLLELDLSKNKVLRMASSTFRHLTDLRRLNLADNSIVELVQRNFFMLSRL
KYLDLSGNPLQDLQPDVFRDVPELKVLKCRNCQLKKINPQMYNLLPLLSELDLGRNEFKF
LDKDEFRDVKRLTKVLLDGNQLSVVVDQLFRMQKSLNHLDLSYNRLAKVPNDSFLQLTNL
TFLDLSYNKLVRLEPQSIRSLSNLLTLNISGNVLMDLREMRETFELIPQLTHLAIADMGT
MPVGLLHPFKQLRYLNISGNSLNNTALEVIDPCRELEFLDLSRNQLHGISEDTVLRIQGI
RNVRLDNNPLICDECHMGKLINVVRQLQWKWDTYPICFLPKSLRGAEINNLDINGLHTCL
TFITDEEQNAASTSYNFLEHGGLNTLAILGGIIFVLIAVIILSLVACFSKNRARYYTRED
HLNGSESKCLEKNLEATTITTLGNGSSPTTTTTLTLATSPAAPNGPKTNGQGLSLSPANG
STPVHGISDDKGKEINFTFPVDDRVCTIDELMPSPPPPPQQHPHPNMGSLMYSVSHSPNS
ATTLAAVAAAATVIPPGAPSHSSMPTPTPTPAEAVVVVLPPPPLPPQQHHHQMDGSLASL
REVQQQLVHLSSTLEPLVSVN
Download sequence
Identical sequences Q9VJA9
7227.FBpp0080582 FBpp0080582 FBpp0080582 FBpp0080582 NP_609861.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]