SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080615 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080615
Domain Number 1 Region: 25-319
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 4.67e-50
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080615   Gene: FBgn0032671   Transcript: FBtr0081062
Sequence length 425
Comment pep:known chromosome:BDGP5:2L:18157110:18158686:-1 gene:FBgn0032671 transcript:FBtr0081062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEERDGDVLLQLHPEEVVETDPQLPEEIERCSGLDYNDFFWRYMHKNIPVIIANVSND
WECQNWTVGQSSPESRDLNSNPSASSINFDYLKTKISDGPVPVANCNSSYFNSHTKLELN
FHDYLAKWRSSIESQSSAAWTSAEVNSNVAPASGDNLYLKDWHLAAQMPGYNFYKVPKYF
ASDWLNEQLIQQGKDDYRFVYMGPKNSWTSYHADVFGSFSWSTNIVGLKKWLIMPPGEEL
KLNDRLGNLPFSIDEKMLDEHNVRYYTINQRANEAVFVPSGWFHQVWNLTDTISVNHNWF
NGCNISMVWQNLKNNLKAVCNEISDCQQMDNFEAHCQTMLRASFGINYLDFIELLEFIAA
RRLAEGTVATKFLLFDSYTMNDYHVQYDLECLWKITRTLTEDPTIQCSPLQLEDRCQGLL
ARLEF
Download sequence
Identical sequences Q9VJ97 X2JEJ1
NP_001286031.1.81976 NP_609870.1.81976 FBpp0080615 FBpp0080615 7227.FBpp0080615 FBpp0080615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]