SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080686 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080686
Domain Number 1 Region: 435-708
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.21e-61
Family Ankyrin repeat 0.00057
Further Details:      
 
Domain Number 2 Region: 62-142
Classification Level Classification E-value
Superfamily RING/U-box 1e-22
Family ZZ domain 0.0097
Further Details:      
 
Domain Number 3 Region: 3-75
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 5.36e-22
Family Mib/herc2 domain 0.0014
Further Details:      
 
Domain Number 4 Region: 147-221
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 4.71e-21
Family Mib/herc2 domain 0.0013
Further Details:      
 
Weak hits

Sequence:  FBpp0080686
Domain Number - Region: 1000-1046
Classification Level Classification E-value
Superfamily RING/U-box 0.000254
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number - Region: 917-960
Classification Level Classification E-value
Superfamily RING/U-box 0.0363
Family RING finger domain, C3HC4 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080686   Gene: FBgn0086442   Transcript: FBtr0081142
Sequence length 1049
Comment pep:known chromosome:BDGP5:2L:19034444:19041541:1 gene:FBgn0086442 transcript:FBtr0081142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRASIPPGIRVVRGPNWIWSNQDDGEGHVGTVCEIGRCGSTHSPENTVVVNWDSGHRTNY
RVGYQNQYDLIIVDNAQVGVRHSNVVCDGCSKAGIAGIVFKCAQCPNYHLCAYCYAEDLH
DIEHPFIRYTTPNSLGVRLPMRKGAKRIQLRGIFVGSKVVRGPDWEWNEQDGGEGRTGRV
MEIRGWDNESCRSVANVAWVTGSTNVYRLGHKGNVDLKYITATCGGHYYKDHMPVLGQTE
ELQPVAPMVKPSFSVGDRVKVCLEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGD
IRVQYENCPNRWTFHPAALVKVVSFRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGK
ICKVVKVYSDGDLRIQQLDDGFEWTLNPKCVKLERSPLATAAERSNSMMDLSHRRADHVM
TPLSGLSGSSVADKLVREAAQGHLDFVRQYLDVNPSQVDVMSGGKACIQVASHQGYVDLV
SYLISKGANVNAVDKEGDSALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHK
KTPHCVRELLQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNV
LHHAALKGNVVAARRILLLSRQLVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDI
RNNRQQTPFLLAVSQGHAGVIERLVRLSCDVNAKDEDGDNAMHLCVIKKSNLQSAAEPQP
EEAPEIHKFYLSLVHSSIRPEDRLMYSILIYLSRAGCRVELNNANASIFEWITDRHIRQL
IFGQQGEAESLPRNLQALEVSAGSADGEESSASAGAESNGAGPGSVAAPPPPQRQTFELM
PKPNDIPAIGVGASPSTPSASPGVKKLNSDATPQNVSPQVAPRKKAPKPPVTTSSSSTAL
EAGAAGPSTSPVIVPGPHECIVCNEILPMVRFEPCQHQIACEECGIRMKKCLRCAVAIER
RLTVSGRVVALPTSTSSPSDPTRLPSGDLLRYLENKVLEFEESHFCGICMERKRDVAFLC
GHGACSHCAETLRTCHMCRKTILKKINLY
Download sequence
Identical sequences Q9VJ14
FBpp0080686 7227.FBpp0080686 NP_001260554.1.81976 NP_001260555.1.81976 NP_609933.1.81976 FBpp0080686 FBpp0080686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]