SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080805 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0080805
Domain Number - Region: 179-221
Classification Level Classification E-value
Superfamily RING/U-box 0.000217
Family RING finger domain, C3HC4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080805   Gene: FBgn0032812   Transcript: FBtr0081264
Sequence length 311
Comment pep:known chromosome:BDGP5:2L:19580612:19582474:-1 gene:FBgn0032812 transcript:FBtr0081264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTEEVKRGRGRGRGTRARGRGRGRGRGRGKKIDDSSIADAAALAASSCAALEDSPGRLD
ASEDSVMQELDKDGELETPGALEEPLPHGALGAVAASGNMTPATQQPQVLQQVPPPVMSQ
TTISLSLARAVDMEADISQLEAPTFTTLSRGPPEPMLRLKWNHKVSLIGEKVLNPMIHCC
DQCDKPILVYGRMIPCKHVFCLKCARAEPIKSCPRCTDKVLRVEQSGLGTVFMCTHGGSR
YGSSGCRRTYLSQRDLQAHINHRHVAPQPPPLQPQPQLSAMAEQPKMTDLGGVGLGLELH
KQRKASGSYGS
Download sequence
Identical sequences Q8INV9
FBpp0080805 NP_724217.1.81976 FBpp0080805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]