SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080819 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080819
Domain Number 1 Region: 305-374
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.61e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 2 Region: 240-302
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000118
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 178-254
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000236
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 4 Region: 357-421
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000306
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 5 Region: 121-176
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000128
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 516-584
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000089
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 7 Region: 574-648
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000459
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 8 Region: 933-982
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000195
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 9 Region: 468-517
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000403
Family Complement control module/SCR domain 0.0041
Further Details:      
 
Weak hits

Sequence:  FBpp0080819
Domain Number - Region: 1011-1056
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000126
Family Complement control module/SCR domain 0.0043
Further Details:      
 
Domain Number - Region: 1156-1220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00208
Family Complement control module/SCR domain 0.0057
Further Details:      
 
Domain Number - Region: 1246-1288
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00375
Family Complement control module/SCR domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080819   Gene: FBgn0032797   Transcript: FBtr0081281
Sequence length 1356
Comment pep:known chromosome:BDGP5:2L:19508953:19517192:-1 gene:FBgn0032797 transcript:FBtr0081281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRLLLQCLVTTILVYKVISVPTSTMSTSIQTTSEIPQQDDDDDDWEEDDDSLESDDDGR
VYKNPRNSPSTECPRDEEQATLLGQKCLRKCSSDEDCKSKKKKCLCDGVCGNSCIKPDRE
CPELAQPSLGQVTVAGRHFGARASYACPHGYHVVGLQSRLCQADGNWAGAEPACKQNIYC
LKPPQIEHARNSALPEQETFDLDSTVQYHCHTGYVTNGFPRAKCLAIDNLASWYGPDIQC
EPRSCGQPPDPAYGWHAGECYTYGCKITYNCGTGYELVGKHERYCQSDGSWTPKELPTCV
LVTSVVCPTPENPKNGKATYTTLAYNSVVSYECRYGYTLVGESSSRCGADRKWSGTLPTC
KEINCGHPGVLYNGWIENIEAGTGLGASIIFRCQPEMMINGLGSSVCQIDGRWRNALPEC
LAPCVVPTISQGNVYPIEIITDENGTTIVHPPTTTTQSPTQTQSIGGVEKVKHGTALEVK
CDENYEFPVSLLSPPTCNNGTWSIIPRCVPARCKSMPRPPKHGMVMAPKTEHGMKARFKC
KDGFKLVSPEGKDVTDPHDYVLTCSFGNWTGETPKCDEVFCSFPGYIPNGKVLLVGNMGL
YDYRPYVKKIVNNKQIMYDCDKGYVLEVGPPGATCVGGKWRPLDLPQCLLGQHPRLRWNR
RRRRSLQIRQLRSMYLLQRQRQLQRQLIDNQNYIKATDPVQPSVHRVKRSASPHPNSQPY
ASDVDRAYSKYYQKIKERYQRYVRKMLGRDRIYQRLHSQDAVGRVGNNLNTHDGGQVTMR
GKSNFREFENGNNYLGSGGIGSGGVVGSGVVALPNINQASRNHQVHVNRTPKEELLSNGS
PPIASRSLHLNATRSYIEQLKSQIVRRRRRRSSSIGQSPPPSGATIPDAEVDISDGGEAG
KGGGGKRLRGPCEELEWDSFANVTTVRPGKVPGRNAVGIMLHLECNAGFKLNIKGENATA
RCIRGIWKPETPKCLSAPCLVPAVEHGQYYKVEPHTKQLSDKPSLTPLSTYEEIQSNEFI
TLECEDGFNIQGSAQLRCAHGSWSVNAFSECTSVPCTLPNIPGVIYDGGYRAGLTIGHGS
SVSVRCELSTNANPIEMSCHKGILTPPSIPCESGLRKSREELEHATPTPHPKVEHNELDN
DHDHHDNGTDEHDDMKMCGPPMLTDGALVYKNADHPELDGAYESGTEIFFNCIPNAAGDR
QTWRIICDNGLWIGRSYNCENGTCVFRNNEANVVSFYNDLEIREDVVDFPPGATIISRCM
DIGKFSFMGSHERTCIHSEWTNTKPVCSGLNQENDYAMEKAPTILFRHQNGPIAQSNDGK
LIVYPGTTLHMECLWMRRFGNPKWNVSHTHKWVSGG
Download sequence
Identical sequences Q9VIU9
FBpp0080819 FBpp0080819 NP_724204.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]