SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080828 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080828
Domain Number 1 Region: 258-571
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 6.72e-67
Family FMN-linked oxidoreductases 0.0000643
Further Details:      
 
Weak hits

Sequence:  FBpp0080828
Domain Number - Region: 113-131
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0235
Family CCCH zinc finger 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080828   Gene: FBgn0032819   Transcript: FBtr0081290
Sequence length 604
Comment pep:known chromosome:BDGP5:2L:19758879:19760986:1 gene:FBgn0032819 transcript:FBtr0081290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSGICYIKPEYLVTEADGGSAAANTENSDTNKRKREDGGEVEAGEKKKWDKKERKRGQN
KNRPVFKDERYSHLCHSLIDGTGGEPCSLANCRYVHDLDAYLAAKGEDLGPECYVYTTKG
YCARGVSCRFAKAHTDEQGRNLKREDYDENAPPTTCNGVSSELQVRLRKHEYDFSRSKEL
IKMAEKLRDARKLKEQQEKEKNPSEETGEKQPSETTEILDAEKQTDTKSKPTATGCAIDD
SAIGRDADHKPAVDFREKLVLSPLTTLGNLPFRRICKEFGADITCGEMACAQPLLKGMGQ
EWALTKRHQSEDVFGVQLCGNNPNMLNQAAQVIHETAQVDFIDLNIGCPIDLIYQQGGGS
ALMRRTNILELTVRSCAALSDRLPFTVKMRTGIYADKSVAHELLPLVEEWGASAVTLHGR
SREQRYTKHANWAYIEECAAKAKCMPVIGNGDILSYEDYMERRTLAPHVCSVMIGRGALI
KPWIFQEIKEKQAWSPSSGQRYEMLQKFCNYGLEHWGSDTKGVETTRRFLLEWQSFLYRY
IPEALQTAPPQKINARPQKYRGRDEMETLMSSGNAADWVKLSESLLGRVPEGFTFVPKHK
ANAF
Download sequence
Identical sequences Q9VIS4
7227.FBpp0080828 FBpp0080828 FBpp0080828 FBpp0080828 NP_610000.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]