SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081098 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081098
Domain Number 1 Region: 36-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000511
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 2 Region: 154-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000175
Family Complement control module/SCR domain 0.006
Further Details:      
 
Domain Number 3 Region: 11-41
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000497
Family LDL receptor-like module 0.0033
Further Details:      
 
Weak hits

Sequence:  FBpp0081098
Domain Number - Region: 94-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000197
Family Complement control module/SCR domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081098   Gene: FBgn0037493   Transcript: FBtr0081579
Sequence length 270
Comment pep:known chromosome:BDGP5:3R:3097314:3098231:1 gene:FBgn0037493 transcript:FBtr0081579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTFSIARGLNCLNFSQVCDGLADCKDCSDEDGTLCTAFRCLYGACVSPNALCNHIPDCL
DGSDEMAEKDVKNAWKVCRLEDPSKSLVVENYVGGTTFQSTAFVPDKTVVHLSCRNGYAL
IGEEKNICDQDQCRYPLSWCVPQCKHVGNLSHTRQCTLNGRPIDCDQSVLPMGTLMSVTC
SSGYEKTGGDGLQFCDETGSWRGHKPEFTVVCHATIVSPYILVATEICFRNVAIKSVAST
EPLFYTYNSFLAHEPHPFKLHNVSHIHYVT
Download sequence
Identical sequences 7227.FBpp0081098 FBpp0081098 FBpp0081098 FBpp0081098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]