SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081102 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081102
Domain Number 1 Region: 137-277
Classification Level Classification E-value
Superfamily L domain-like 8.16e-18
Family mRNA export factor tap 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081102   Gene: FBgn0051501   Transcript: FBtr0081583
Sequence length 301
Comment pep:known chromosome:BDGP5:3R:3172555:3173558:1 gene:FBgn0051501 transcript:FBtr0081583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFATPRNNSSEGPLCHSTPRSVKGDFKFESKNGARLPRSIYGWYRVLIYSTDRRLTFNRV
LRRIRCILTPLKINPRYKHTGGEQDTAEDSWALFTFFVDSYDVASALFRRGWVDNQIWLK
VSDRMPKIWINSILRLHLTMVLLDRYDPVERSLDLTLFYKDKALCGEFFALAESNCMSTV
LGIVDREMPELERLILDGNHLTNLWVFRKVERRFPRLHSISLKHNDIENIYSLRNLQFLP
LAELNLLDNPLPAGYEKEVLDIWPSLQVLNKIQVTPDPAMMQLVERVLQHTGTKREFFRF
F
Download sequence
Identical sequences Q8INS6
FBpp0081102 7227.FBpp0081102 FBpp0081102 NP_731156.1.81976 FBpp0081102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]