SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081291 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081291
Domain Number 1 Region: 54-416
Classification Level Classification E-value
Superfamily L domain-like 9.86e-44
Family Polygalacturonase inhibiting protein PGIP 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081291   Gene: FBgn0037552   Transcript: FBtr0081795
Sequence length 533
Comment pep:known chromosome:BDGP5:3R:4043700:4045456:1 gene:FBgn0037552 transcript:FBtr0081795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLIIIALLASVSALGRPDLEDYCNDSYCHLLGRSRTFSDKKATKLTEFHMDSCEKKVLK
LMPNLRTLELENCDSPDFTMNDLNQLPYLTSLQLRRGNLLGLHDEHFSKWPNMKILMLGG
NNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLHENIFT
GVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMSNCGPLPDLSLPGAHTLILDNSGVQR
LDILGSVHKLQARKNHITEIKLPDKSSVIELDLHSNLLTATDIPKLLTGMWRLQRLDLSE
NIIGIYAAAGSDNTSELFILPNLMYMNLSANRLTRLHFDSPIPWERLTHLDASYNRIYAP
AKVGIDEAFNLQSLHLEGNYINNFELTPWKPHPSLKEVALYDNKFQPKGYKNITKFFNEI
GVNVLEKTQYSQSNNTTPTCKPCIPDARDFPTSISADTNQTIDTKVNPLSNDTYQWNVWN
VLMLVSLIVSLFVNSFLIVKLIRLRGRNQFTQSSSVPAIIEMFSNESDDEIIL
Download sequence
Identical sequences Q9VHV3
7227.FBpp0081291 FBpp0081291 NP_649770.1.81976 FBpp0081291 FBpp0081291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]