SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081303 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081303
Domain Number 1 Region: 9-65
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000695
Family ZZ domain 0.014
Further Details:      
 
Domain Number 2 Region: 66-120
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000079
Family Homeodomain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081303   Gene: FBgn0037555   Transcript: FBtr0081807
Sequence length 418
Comment pep:known chromosome:BDGP5:3R:4062838:4066234:-1 gene:FBgn0037555 transcript:FBtr0081807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTIADLFTKYNCTNCQDDIQGIRVHCAECENFDLCLQCFAAGAEIGAHQNNHSYQFMDT
GTSILSVFRGKGAWTAREEIRLLDAIEQYGFGNWEDISKHIETKSAEDAKEEYVNKFVNG
TIGRATWTPAQSQRPRLIDHTGDDDAGPLGTNALSTLPPLEINSDEAMQLGYMPNRDSFE
REYDPTAEQLISNISLSSEDTEVDVMLKLAHVDIYTRRLRERARRKRMVRDYQLVSNFFR
NRNYAQQQGLTKEQREFRDRFRVYAQFYTCNEYERLLGSLEREKELRIRQSELYRYRYNG
LTKIAECTHFEQHAATATHRSTGPYGHGKTLHCIINAPNNERSNGSIRQCLTTGPHAYLQ
WKSSAAKLFLALPTTESQKGRNVKRRRGKFKFNRTKKHAPHRRPDLLRRIIAQQKLLG
Download sequence
Identical sequences A0A0B4KFU2
NP_001262367.1.81976 NP_649773.1.81976 FBpp0081303 FBpp0081303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]