SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081445 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081445
Domain Number 1 Region: 233-300
Classification Level Classification E-value
Superfamily RING/U-box 2.1e-22
Family RING finger domain, C3HC4 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081445   Gene: FBgn0037653   Transcript: FBtr0081965
Sequence length 380
Comment pep:known chromosome:BDGP5:3R:4832174:4833752:1 gene:FBgn0037653 transcript:FBtr0081965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAMVVEDRPAEAKRFFCHMCNVEINIPNSDFTCPLCANGFVEELPANAPEMDSSTAGA
SGSARSGSSGSGSSGSHDTLSRGSSSSGSQVNVESLRNDIVSLLNMRNVPNLEITIEPNR
RHSNVLHLGGFGGPSGSDSARGLTAGGRVRPANLDRLDNVLFDFLQSLPLAGATAEIVTG
PGGGGVGGGGNSHMFFMGNPGDYAWGREGLDTIVTQMLNQMETSGPPPLSAQRINEIPNV
QINAEEVNRKIQCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICRKSLADD
GNDADDEFVMLDAFGPEMAADGSNSERRSASTATGTDNPSPANNPSQAAAEGGRTRPDAN
PAQAARNNIFTFDDDNMFLD
Download sequence
Identical sequences Q9VHI7
NP_649859.1.81976 FBpp0081445 FBpp0081445 FBpp0081445 7227.FBpp0081445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]